KEGG   Mycoplasma haemofelis Langford 1: HF1_00300Help
Entry
HF1_00300         CDS       T01418                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mha  Mycoplasma haemofelis Langford 1
Pathway
mha00450  Selenocompound metabolism
mha00970  Aminoacyl-tRNA biosynthesis
mha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HF1_00300 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HF1_00300 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mha01007]
    HF1_00300 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mha03016]
    HF1_00300 (metG)
Enzymes [BR:mha01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HF1_00300 (metG)
Amino acid related enzymes [BR:mha01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HF1_00300 (metG)
Transfer RNA biogenesis [BR:mha03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HF1_00300 (metG)
 Prokaryotic type
   Other AARSs
    HF1_00300 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f SOP4
Motif
Other DBs
NCBI-ProteinID: CBY92038
UniProt: E8ZGG8
Position
29372..30931
Genome map
AA seq 519 aa AA seqDB search
MAKDRSVYITTPLFYPSDKPHLGHAFTVVLADVLKLSYKQLGYGGYLVVGTDEHGEKMLA
AADAAQTPVERFVESNVLHFKSLWETLGIKYDRFVRTSDHAHRALVKQVFLQLLSDNQIF
IDEWRGWYCTSCEESFSDRFIGKKSTCPIGHPLTLRAEKTYFLRVTSFRNWLRREFEANK
DLIYPDKYKTELMNNFINDLDDLSITREGLDWGIKVPEDEDHTIYVWFDALIAYLTALNF
GNYGRTNTTTFKNYWESSKCKVIQIIGKEVCRFHAIYWPIMLKNLKVRLFDNLLVHGWLL
MNNEKMSKSKKNVIDPKEILNLMPREGLRFYLARISILGDANVNVDDIFSVYNSYLVNTY
GNLISRFYGIMGRKYENTLPNQWDPESFIEIDQLNIELDEFLNNGYEKEVLNNTISPIIE
KVFEIFRSAGKLIEKNKAWELEKGDLLLDTLMVFIYKLLCIGTWFLHPILIDTAPKLYDI
LNISPKKVGIEYLQQQRLYFKKKINDLPENLFPRIKDID
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagataggtcagtctatatcactactcctcttttttatccttcagataagccc
catttagggcatgcttttacagtagttcttgcagacgttttaaaacttagctataaacag
ttaggatacggtggttacttggttgttggtaccgatgaacacggggagaagatgttggct
gccgcagatgctgctcaaactccagttgagagatttgtagagtctaacgttcttcacttt
aagagtctgtgagagactctaggaattaaatacgataggtttgttagaaccagcgatcac
gctcacagggctttagttaagcaagtttttcttcaacttttaagtgataaccagattttt
atagatgaatggagaggttggtactgtacttcgtgtgaggaaagtttttcagatcgtttt
attggtaaaaaatcaacttgtcctatcggtcacccattgactttaagggcggagaagact
tatttcttaagggttacctcttttagaaactggttgagacgtgaatttgaagccaataag
gatttaatttatccggataagtacaaaaccgagttgatgaacaacttcatcaatgatttg
gatgatctatcaattactagagaagggttagattgagggataaaggttccagaagatgag
gatcacaccatctatgtttggtttgatgccttaatcgcctaccttactgctttaaatttt
gggaactacggaagaacaaataccactacatttaagaattactgagagagctctaagtgt
aaggttattcaaattatcggtaaggaggtttgcagattccatgctatttactgaccgatc
atgcttaagaatctgaaagttagattgtttgacaatcttcttgttcatggttgattactt
atgaacaatgagaagatgtctaaatctaagaagaatgttattgatcctaaggagatcttg
aatttgatgcctagagaaggattgagattctacttggcaaggataagtattctcggggat
gcgaacgttaatgttgatgatattttcagcgtttacaactcatatctagtgaatacttat
ggtaatttaatctctagattttatggaataatgggtagaaagtatgagaatactcttccg
aaccagtgggatcctgagagctttatagaaatagatcaacttaatatagagctggatgaa
ttcttgaataatggctatgagaaggaagttcttaacaacactatttctccaataatagag
aaggtatttgagatatttagatctgcaggtaagttaattgagaagaataaggcttgagaa
ttggaaaagggagatcttctgttggatacattgatggtgttcatatacaaactcctatgt
attggaacttggttccttcatccgattttgatagatactgctcctaagttatatgatatc
ttgaatatctctcctaagaaggttggtatagagtatctacaacaacagagactttacttc
aagaaaaagataaatgaccttcctgagaatctatttccaagaataaaagacattgattaa

DBGET integrated database retrieval system