KEGG   Mycoplasma haemofelis Langford 1: HF1_02220Help
Entry
HF1_02220         CDS       T01418                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mha  Mycoplasma haemofelis Langford 1
Pathway
mha00230  Purine metabolism
mha01100  Metabolic pathways
Module
mha_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HF1_02220 (gmk)
Enzymes [BR:mha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HF1_02220 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 RsgA_GTPase AAA_16 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CBY92230
UniProt: E8ZKR4
Position
211139..211720
Genome map
AA seq 193 aa AA seqDB search
MGSRKLGKLFIISGPSGVGKGAIIERLLSNKELNLIFSISHTTRSRRSNEVDGVNYFFIT
KEQFRLNIESGKMLEYAQFFDNYYGTSKEWVENRLREGRNVLLEIETIGFKQMLEKKIDL
VSIFIAPPSMQELEDRLKNRGTESGQDVKIRLEKATSEMEDSALFQHVVVNDILEDAVRE
IEGIFLSQVLNEN
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggggtcgcgtaaactaggcaaactatttattatatctggcccctctggagtcggaaaa
ggagctattattgaacgactgctgtcaaataaggaattaaacttaattttctccatctcc
cacactactcgaagtcgtagatctaacgaagtggatggagttaactacttctttataact
aaggagcagtttaggcttaatatagaatcgggtaagatgcttgaatatgctcagttcttt
gataactactatggtactagtaaagagtgggtggagaatagacttagagaggggaggaat
gttcttctagagattgagacaataggatttaagcagatgctagagaagaagattgatcta
gtatctatatttatagcccccccttccatgcaggaattggaagatagacttaagaataga
gggactgaatctggacaggatgtaaagatacgtttggagaaggcgacttccgagatggaa
gattcagccctattccagcatgtggtggttaatgatatattggaggatgctgttagagag
atagaggggattttcctaagtcaagttttgaatgaaaattaa

DBGET integrated database retrieval system