KEGG   Mycobacterium haemophilum: B586_03330Help
Entry
B586_03330        CDS       T04111                                 

Definition
(GenBank) polyketide synthase
  KO
K11628  mycocerosic acid synthase [EC:2.3.1.111]
Organism
mhad  Mycobacterium haemophilum
Brite
KEGG Orthology (KO) [BR:mhad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mhad01004]
    B586_03330
Enzymes [BR:mhad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.111  mycocerosate synthase
     B586_03330
Lipid biosynthesis proteins [BR:mhad01004]
 Polyketide synthase
  Modular PKS
   B586_03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR PS-DH Ketoacyl-synt_C ADH_zinc_N ADH_zinc_N_2 KAsynt_C_assoc PP-binding adh_short Thiolase_N ADH_N
Motif
Other DBs
NCBI-ProteinID: AKN15812
Position
complement(4038720..4045124)
Genome map
AA seq 2134 aa AA seqDB search
METRVTPIAVIGMGCRLPGGINSPDQLWESLLGGDNLVTEVPADRWIADDFYDPEPGVPG
RSVSRWGGFLDDVAGFDAEFFGISEREATSIDPQQRLLLETSWEAIEQGGLDPASLAGSS
TAVFTGLTHEDYLVLTTAAGGLASPYVVTGLNNSVASGRISHTLGLHGPAMTFDTACSSG
LMAVHLACRSLHDGESDLALAGGCAVLLEPHASVAASAQGMLSSSGKCKSFDADADGFVR
SEGCAMVLLKRLPDALRDGNRIFAVIRGTATNQDGGTETLMMPSEDAQVAVYRAALAAAG
VEPETVSVVEAHGTGTPIGDPIEYRSLARVYGAGTPCALGSAKSNMGHSTASAGTVGLIK
AILSLRHGVVPPLLHFNRLPDELSDVETELFVPQAVTPWPNGDGQAPKRVAVSSFGMSGT
NVHAIVEEAPAEAATPDAPQTSTGDATAGPRLFMLSATSSDALRETARRLATWVEERQDS
VTSSDLAYTLARGRAHRPVRTAVIAADLPELVAGLREVADGDALYDAAVGQGDRGPVWVF
SGQGSQWAAMGTQLLASEPVFAATIAKLEPVIAAESGFSVTEAITAQETVTGIAHVQPAV
FAVQVALAATMEQTYGVRPGAVIGHSMGESAAAVVAGALSLEDAARVICRRSKLMTRIAG
GGAMGSVELPAKQVNSELMARGIDDVVISVVASPQSTVIGGATETVRDLIARWEQRDVMA
REVAVDVASHSPQVDPILDDLAAALADIAPMTPKVPYYSATLFDPRERPVCNGAYWVDNL
RNTVQFAAAVQAAMEDGYRVFAELSPHPLLTHAVEQTARNLDMSVATLAGMRREQPLPHG
LRGLLTDLHRAGAALDFAELYPAGRLLDAPLPVWTHPRLFIDTDGQEQRAQGACTVTVHP
LLGSHVRLLEEPERHIWQGDVGTAALAWLADHQVHNVAALPGAAYCEMALAAAVEVFGEA
AEVRDIAFEQMLLLDEQTPIDAIASVDAPGVINFMVQANQDGEKTRNATATLHAADDAEG
DGPPPAYDIAALLEAHPNSVNGTDMRESFAGRGVQLGAAFAGLATAHTGEAEAGTVLAEV
ALPASIRFQQSAYHIHPALLDACFQSVGAGVDATKASSKGGLLLPLGVRSLRAYGPTRNA
RYCYTRLTKIEARGGEADLDVLDEHGTVLLAVRGLHMGTGTTERGELDRQLSERLLTLGW
QQRTLPEATHVEPGSWLLIDTANAVDTPDMLASTLTDALKSHGPQGTECANLSWSIQDDP
AASREKLGSQLRGRDGVVILYGPRAGDPDEQGLLAGREQVRHLVRITRELAELEGELPRL
FIVTRQAQIVQSDDKANLEQAGLRGLLRVISSEHPMLHPTLIDVDEHTDVERVAQQLLSG
SEEDETAWRNGDWYVARLTPSPLSHEDRRTVVLNPEHDGMRAHVRKPGDLQSLELVASDR
VPPGPGQLEVAVSMSSINFADVLIAFGKFPIIDDREPQLGMDYVGVVTAVGEGVTGHQVG
DRVGGFSEGGCWRTFLTCDANLAVTLPSGLTDEQAITAATAHATAWYGLNDLAGIKAGDK
VLIHSATGGVGQAAISIARAKGAEIFATAGNPTKRAMLHDMGIEHVYDSRSVKFAEQIRS
DTDGYGVDIVLNSLTGAAQRAGLELLAFGGRFVEIGKADVYGNTRLGLFPFRRGLTFYYL
DLALMSVTQPDRVRELLATVYQLTADGVLTAPECTHFPLTDAANAIRAMSNAEHTGKLVL
DIPRSGSRSVAVPPEQAPVYRRDGSYIITGGLGGLGLFFASKLAEAGCGRIVLTARSQPN
PKARQTIERLCEAGADIVVECGNIAEPDTADRLVSAATATGLPLRGVLHSAAVVEDATLT
NITDELIDRDWSPKVYGSWNLHRATIGQPLDWFCLFSSGAALLGSPGQGAYAAANSWVDL
FAHWRRAQGLPVSAIAWGAWGEVGRATFLAEGGEIMITPDEGAYAFETLVRHDRAYSGYI
PILGAPWLPDLVRRSPWGEMFASTGQGSRGPSKFRMELLALPQDEWSGRLRRLLVEQASV
ILRRTIDADRSFIEYGLDSLGMLEMRTHIESETGIRLTPKVIATNNTARALAQYLADTLA
QEEGAAAPEAATPAAAATPEAAAAPDAPEAPEES
NT seq 6405 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacgtgtcactcccattgcggtcatcggaatgggatgtcggcttcccgggggc
atcaactcgccagaccagctatgggagtcgttgttgggcggcgataacctggtcaccgaa
gttccagccgaccgttggatcgctgacgacttttacgaccctgagccgggggttcccggg
cgatcggtatcgcgatggggtggtttcctcgacgacgtcgccggtttcgatgctgagttc
tttgggatcagcgagcgggaggccacctcgatcgatccgcagcagcgattgctgctggaa
acctcgtgggaggcgatcgagcagggtggtctggatccggcgtcattggccgggtcctcg
acagccgtttttactggcctgacccacgaggactatctagtactcaccaccgctgcgggc
ggtttggccagcccgtatgtggtaaccggcttgaacaacagtgtggcgtccgggcggatc
tcgcacacattgggcctgcacggtccggcgatgacgtttgacaccgcgtgttcgtcgggt
ctgatggcggtgcacctggcctgccgcagcctgcacgacggcgaaagcgacctcgctttg
gcgggaggctgcgcagtgctgctggagccgcacgcaagtgtggcggcgtccgcgcagggc
atgctttcgtccagcggtaagtgcaagtcattcgacgccgacgcggacgggtttgtgcgt
tccgaaggctgcgcgatggtgttgctcaagcgactgccggatgcgctgcgcgacggcaac
cggatcttcgccgtgatccgcggcacggccaccaaccaggacggtggcacggagacgctc
atgatgccgtccgaggacgcccaggtcgctgtgtaccgggcggcattggcggcggcgggc
gtggagcccgaaacggtcagtgtggtggaggcgcacggcaccggcacaccaatcggtgac
ccgattgagtaccgcagcctggcgcgcgtgtatggcgcgggcactccctgcgcgctcggt
tcggccaagagcaacatggggcacagcacggcatcggcggggacggtcgggctgatcaag
gcgattctgtcactgcggcacggggtggtgccgccgctgctgcacttcaatcggctgccc
gatgagctttccgacgtcgagacggaactctttgtgccgcaggcggttacgccatggccc
aacggagacggtcaggcgccgaagcgggtcgcggtgtcctcgttcgggatgtcgggaacc
aatgtgcatgccatcgtggaagaggccccagcagaagctgccacacctgacgcaccccag
acgtcaaccggagacgctacggcgggcccgcggctgttcatgctgtcggccacgtccagc
gacgcactgcgggagaccgcacgccggctcgccacgtgggtggaagaacgccaggactcc
gtgacgtcgtcggatctggcttacacgttggcgcggggccgcgcgcaccggccagtgcgc
accgcggtgattgccgccgacctgcctgagcttgtcgcgggtttgcgtgaggtcgccgac
ggtgacgccctatatgacgccgcggtgggacaaggtgatcggggaccggtctgggttttc
tccgggcaagggtcgcagtgggcggcgatgggtacgcaattgctggcgagcgaaccagtg
ttcgcggccaccatcgccaagctggagccggtgatcgctgcagagtcgggattctcggtg
accgaggcgattacggcgcaggagacggtgaccgggatcgctcacgtgcagccggcggtg
ttcgccgtgcaggtcgcgttggccgccactatggagcaaacctacggagtgcgcccgggc
gcggtcatcggacactcgatgggtgagtcggccgcggccgtcgttgcgggggcgctgtca
ctcgaagacgcggcgcgtgtcatctgccgccgctcgaagctgatgacccgcatcgccggt
ggcggggccatgggatcggtggaattgcctgccaagcaagtgaattcggagctcatggcc
cgcggcatcgacgatgtcgtgatctcggtggtggcttcgccgcagtccacggtgatcggc
ggcgccaccgaaactgtgcgcgacctgatcgcgcggtgggagcagcgtgacgtcatggcg
cgcgaggtggctgttgacgtggcgtcgcactcgcctcaagtcgatccgatactcgacgat
ttggccgcggcactggccgacatagccccaatgacaccgaaggttccctactactcggcg
accctgttcgacccgcgtgagcggccggtgtgcaacggcgcttattgggtggacaacctg
cgcaacaccgtgcagttcgccgcggcggtgcaggccgcgatggaggacggctaccgggtc
ttcgccgagctgtcaccacacccgctgctgacccacgcggtcgagcagaccgcccgaaac
ctcgacatgtcggttgccaccctggccggcatgcggcgcgagcagccgctgccgcacgga
ctgcgcggcttgctgaccgacctgcaccgcgcgggcgccgcgttggacttcgcggagctg
tatcccgcgggccggttgctggatgcgccgctgccggtgtggactcacccccgcttgttc
atcgacaccgacgggcaagaacaacgggcgcaaggtgcctgcactgtcaccgtgcatccg
ctgctgggctcgcatgtgcggctgcttgaggaacctgagcgccacatttggcagggcgac
gtcggtaccgcggcattggcctggctcgccgaccatcaggtgcataacgtcgccgctctc
cccggcgccgcctattgtgaaatggcgttggctgcggccgtggaggtcttcggcgaagcg
gccgaagtccgtgacatcgcttttgagcagatgctgttgctcgacgagcagaccccgatc
gacgccatcgcgtcggtggatgcgcctggtgtcatcaacttcatggtgcaggcgaaccag
gacggggaaaagacccggaacgccaccgcgacgctgcacgccgccgacgatgccgagggt
gatggtccaccaccggcgtatgacatcgctgccctgctggaggcgcatccgaatagcgtg
aacgggaccgacatgcgggaatcgttcgctgggcgtggtgttcagctgggtgctgcgttc
gccggcttggccaccgcgcacactggcgaggcggaagccggcaccgtgctggccgaggtc
gcgctgcccgcttcaattcgcttccaacagagcgcctaccacattcacccggcgttgctg
gacgcctgcttccaatccgtcggcgccggcgtcgacgccaccaaggccagcagcaagggt
ggcctactgctgccattgggtgtgcgcagcctgcgtgcctacggacctacccgcaatgcc
cgctactgctacacacggttgaccaagatcgaagccagaggcggtgaggccgacctcgac
gtgctcgacgagcacgggacggttttgttggccgtgcgtgggctacacatgggaactggg
accaccgaacgcggcgagctcgaccgccagctcagcgagcggctgctgaccctcgggtgg
cagcagcggacgctgcccgaggccacccacgtcgagcctggatcgtggctgttgatcgac
accgccaacgccgtagacacccccgacatgttggcttcgacgttgacggacgcgctgaaa
tcccacggcccccaaggcaccgaatgcgccaacctgtcctggtcgatccaggatgatccc
gcagcgagccgagagaagcttggcagccaactgcgtggccgcgacggtgtggtgatcctc
tacgggccacgcgccggcgaccccgatgagcaaggtctgctggccggccgtgaacaggtc
cgtcatctggttcggatcacccgggagctggctgaattagagggcgagttgccgcgtctg
ttcatcgtgaccaggcaagcccagatagttcagtcggacgacaaggccaacctggagcag
gccgggttgcgtggcctgctgcgggtgatcagcagcgaacacccgatgctgcaccccacc
ctgatcgacgtggacgagcacaccgacgttgagcgggtggcccagcaactgctgagcgga
tcggaggaggacgagaccgcctggcggaatggcgactggtatgtggcacgcctgaccccc
agtccgttgagccatgaagatcggcgaactgtggtcttgaaccccgagcacgacgggatg
cgggcgcacgtgcgcaagccgggcgacttgcaatcgctggaactcgttgccagtgaccga
gttccgcccggccccgggcagctcgaggtcgcggtcagcatgtccagcattaacttcgcc
gacgtcctgatcgcattcggcaaatttcccatcatcgacgaccgcgagccgcagttaggt
atggactatgtcggtgtggtcaccgcggtcggggaaggcgtgaccggtcatcaggtcggt
gaccgggttggcggattctccgaaggcggttgctggcggacgttcctcacctgtgacgcc
aacctcgccgtcacgctgccgtccggcttgaccgacgagcaggccatcacggcggccacc
gcgcatgccaccgcctggtatgggctgaacgatctggccgggatcaaggccggcgacaag
gtgttgattcattccgcgaccggcggcgtggggcaggcggccatttcgatcgcccgcgct
aagggtgcggaaatcttcgcgaccgccggcaacccaaccaagcgggcgatgctgcacgac
atgggcatcgagcatgtctacgactcgcgcagcgtcaaattcgccgagcagatccgcagc
gacaccgacgggtacggcgtagatatcgtgctgaactcgctgaccggtgccgcacaacgc
gccgggctggagctgttggccttcggcggacggttcgttgaaatcggcaaggccgacgtt
tacggcaacacccggttagggttgttcccgttccgtcgcggcctgacgttctactacttg
gacctggcgctgatgtccgtcacccagcccgaccgggtccgtgaactgctcgccacggtg
taccagctcaccgcagacggtgtcttgaccgcaccggagtgcacgcacttcccgctgacc
gatgcggccaatgccatccgggcaatgagcaacgccgagcacaccggcaaactcgtgctc
gacataccgcgcagtggcagtagaagcgtggcggtgccaccggagcaggctccggtctac
cgccgcgatggctcctacatcatcaccggtggtttgggtggcctcggcctgttcttcgcc
tcaaagctggccgaggcaggctgcggtcggatcgtgctgaccgcgcgctcgcaacccaac
cccaaagcccggcagaccatcgagcgtctctgtgaggccggggctgacatcgtggtggag
tgcggcaacatcgctgagcccgataccgcggaccggttggtgagtgcggcgaccgccact
gggcttccgctgcgcggcgtgctgcactcggcggccgtggtcgaagacgccacgctgacc
aacatcaccgacgagctcatcgaccgcgactggtcgccgaaggtctacggatcgtggaac
ctgcaccgcgcgacgatcgggcagccgctggactggttctgcttgttctcctcgggagca
gccctgctgggctcgccgggtcagggtgcctacgcggcagccaacagttgggtcgatctc
ttcgcccactggcgccgcgcccagggcctgccggtcagcgcgattgcgtggggcgcgtgg
ggagaggtcggccgcgccacgttcttggccgaagggggcgaaatcatgatcacccccgac
gaaggtgcgtatgccttcgagacgctggtgcgccatgaccgggcctacagcggttatatt
ccgatcctcggggcgccatggttgccggacctcgtccgacgcagcccgtggggtgaaatg
ttcgcatccactgggcaaggttcaaggggcccaagcaaattccgcatggagctgcttgcg
ttgccgcaagatgaatggtccggccggctgcggcgtctgctagtcgagcaggctagtgtg
attctgcgtcggacgatcgacgcggaccgctccttcatcgagtacggcctggactcgctg
ggcatgctcgagatgcgtacccacatcgaatccgagaccggaatacgcctgacccccaag
gtcattgctaccaataacactgcgcgcgccttggcgcagtacttggcggacacgctggcc
caggaggagggggcggcggcaccggaagctgcgacaccggcggctgcggcgacgcctgag
gccgccgcggcaccggacgcaccggaggcgccggaggaatcctga

DBGET integrated database retrieval system