KEGG   Mycobacterium haemophilum: B586_06965Help
Entry
B586_06965        CDS       T04111                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mhad  Mycobacterium haemophilum
Pathway
mhad00071  Fatty acid degradation
mhad00072  Synthesis and degradation of ketone bodies
mhad00280  Valine, leucine and isoleucine degradation
mhad00310  Lysine degradation
mhad00362  Benzoate degradation
mhad00380  Tryptophan metabolism
mhad00620  Pyruvate metabolism
mhad00630  Glyoxylate and dicarboxylate metabolism
mhad00640  Propanoate metabolism
mhad00650  Butanoate metabolism
mhad00900  Terpenoid backbone biosynthesis
mhad01100  Metabolic pathways
mhad01110  Biosynthesis of secondary metabolites
mhad01120  Microbial metabolism in diverse environments
mhad01130  Biosynthesis of antibiotics
mhad01200  Carbon metabolism
mhad01212  Fatty acid metabolism
mhad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mhad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B586_06965
   00630 Glyoxylate and dicarboxylate metabolism
    B586_06965
   00640 Propanoate metabolism
    B586_06965
   00650 Butanoate metabolism
    B586_06965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B586_06965
   00072 Synthesis and degradation of ketone bodies
    B586_06965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B586_06965
   00310 Lysine degradation
    B586_06965
   00380 Tryptophan metabolism
    B586_06965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B586_06965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B586_06965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B586_06965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mhad04147]
    B586_06965
Enzymes [BR:mhad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B586_06965
Exosome [BR:mhad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B586_06965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKN18544
Position
3279183..3280400
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVATARSPIGRAMKGSLVSMRPDDLAVQMVRAALDKVPALNPHQIDDLILGCGLP
GGESGFNMARVVAVELGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGDAFISAGVETV
SRFGKGNSDSWPDTHNPLFTEAQQRSAAAAAGADEWHDPRTDGKLPDVYIAMGQTAENVA
ILTGISREDQDRWGVRSQNRAEEAIKSGFFEREISPVTLPDGSTVSTDDGPRPGTTYEKV
AELKPAFRPNGTVTAGNACPLNDGAAALVITSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPVEACKQALQRAGMSVSDIDLVEINEAFAVQVLGSARELGIDEDKLNVSGGAIALGH
PFGMTGARIATTLLNNLTSYDKTLGLETMCVGGGQGMAMVIERLS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagccgtcatcgttgccaccgcccgctccccgatcggccgcgctatgaagggg
tcgctggtcagtatgcgacccgatgacctggccgttcagatggtgcgcgccgccctcgac
aaagtgccagcgctaaacccacaccagatcgacgacctcatcttgggatgtggcctgcca
ggcggtgagtccggtttcaacatggcccgcgtggtggccgtcgaactcggctatgacttc
ctgccgggcaccacggtcaaccggtactgctcgtcgtcgctgcagaccacccggatggct
tttcacgcgatcaaggccggtgagggcgacgcgttcatctccgcgggtgtagagacagtg
tcgcggttcggcaaaggcaactccgactcctggccggacacccacaatccgctcttcacc
gaggcccagcaacgctcggcagcggccgccgcgggcgccgacgaatggcacgatccccgc
accgacggcaagctgcccgacgtctatatcgcgatgggccagaccgctgaaaacgtcgcc
atactcaccggcatcagccgtgaagaccaagaccgctggggggtacgcagccaaaaccgg
gccgaggaggcaatcaagagcgggttctttgagcgcgaaatttccccggtcaccctcccc
gacggcagcacggtgagcaccgatgacgggccacgaccgggtactacttacgagaaggtc
gccgagctcaaacccgcgttccggcctaatggcaccgtcaccgcaggaaacgcctgccca
ctcaacgacggtgccgccgcattggtgatcaccagcgacacgaaagccaaggaactgggc
ctgacaccgctggcgcgcatcgtgtccaccggagtcagcgggctctcaccggagatcatg
ggcctgggcccggtcgaggcgtgcaagcaggcgctgcaacgcgccggcatgtcggtgagc
gacatcgacctggtcgagatcaacgaagccttcgcggtgcaggtcctgggctcagcccgc
gagctgggaatcgacgaagacaagctgaacgtgtcgggcggggcgatcgcgctaggtcac
ccgtttggcatgaccggcgcacgtatcgctaccacgctgctgaacaacctcaccagctac
gacaagacgctgggtctggaaaccatgtgtgtcggcggcgggcagggcatggcgatggtg
atcgagcggctcagttag

DBGET integrated database retrieval system