KEGG   Mannheimia haemolytica D153: F382_03780Help
Entry
F382_03780        CDS       T02746                                 

Gene name
truA
Definition
(GenBank) tRNA pseudouridine synthase A
  KO
K06173  tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
mhae  Mannheimia haemolytica D153
Brite
KEGG Orthology (KO) [BR:mhae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mhae03016]
    F382_03780 (truA)
Enzymes [BR:mhae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     F382_03780 (truA)
Transfer RNA biogenesis [BR:mhae03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    F382_03780 (truA)
 Prokaryotic type
    F382_03780 (truA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_1 DUF2344
Motif
Other DBs
NCBI-ProteinID: AGQ25125
Position
complement(716802..717587)
Genome map
AA seq 261 aa AA seqDB search
MKIALGIEYDGSRYFGWQRQEAVESVQQQLEQALSVVANSPVEVFCAGRTDAGVHGTGQV
VHFETQANRPLQSWCFGTNAHLPDDIAVKWAVAVNEDFHARFSATARRYRYIIFNQKLRS
AILPKGVTHFHFPLDERKMHQAGQYLLGENDFSSFRAAKCQSNTPWRNIHHLNVSRQGNY
VIVDIQANAFVHHMVRNIVGTLLEIGQGRQPVEWAKWVLEQRDREKAAPTAKAEGLYLVE
VHYPEHFGIPKTPLGPLFLAD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgcattaggtattgaatatgacggcagccgttattttggctggcaacgacaa
gaagcggtagagagtgtacaacaacagctagagcaggcgttgtcggttgttgccaattcg
cccgtagaagtgttttgtgccggcagaaccgatgccggtgtgcacggcacagggcaggtc
gtgcattttgaaacgcaagcaaaccgcccgctacaaagctggtgtttcggcactaacgct
catttacccgatgatattgcggtgaaatgggcggtagcggtgaatgaggattttcacgcc
cgttttagtgccaccgcccgccgttaccgctatattatttttaaccaaaaactgcggtcg
gcaattttacctaaaggtgttacccactttcactttccccttgatgaacgcaaaatgcac
caagcagggcagtatttgctgggcgagaatgacttttcctctttccgtgccgccaaatgc
caatctaatacgccgtggcggaatattcatcatttaaatgtgtctcggcaaggcaattat
gtgattgttgatattcaagccaacgcctttgtacatcatatggttcgcaatattgtggga
acattgctcgaaatcgggcaaggcagacagcctgtggaatgggcaaaatgggtgttggag
caacgtgaccgggaaaaagctgcccctacagcgaaagccgaggggctatatttggtcgag
gtgcattaccctgagcattttggcattccgaaaacacctcttgggccgctgtttttggcg
gattag

DBGET integrated database retrieval system