KEGG   Mannheimia haemolytica D153: F382_06625Help
Entry
F382_06625        CDS       T02746                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mhae  Mannheimia haemolytica D153
Pathway
mhae00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mhae00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    F382_06625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhae01007]
    F382_06625
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mhae03016]
    F382_06625
   03029 Mitochondrial biogenesis [BR:mhae03029]
    F382_06625
Enzymes [BR:mhae01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     F382_06625
Amino acid related enzymes [BR:mhae01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   F382_06625
Transfer RNA biogenesis [BR:mhae03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    F382_06625
 Prokaryotic Type
   Other AARSs
    F382_06625
Mitochondrial biogenesis [BR:mhae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    F382_06625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e Polysacc_deac_3 tRNA-synt_1 tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: AGQ25651
Position
1287807..1289534
Genome map
AA seq 575 aa AA seqDB search
MNIQQILSDKIKQAMVASGADSNVEPLVRQSGKPEFGDYQANGAMGAAKKLGMNPREFAQ
KILENADLNGIADKLEIAGPGFINIFLNPEWLAENTNSSLQAVNFGIKTANPQTIVIDYS
SPNVAKEMHVGHLRSTIIGDAVVRTLAFLGNNVIRANHVGDWGTQFGMLIAYLEKMENEH
ASEMELSDLEAFYRAAKEHYDSDEAFAEKARNYVVKLQSGDKYCLTMWKKLVDITMHHNQ
ENYNRLNVTLTEKDVMGESLYNPMLPEIVADLKAKGLAVEDDGALVVFLDEFKNKDGDPM
GVIVQKKDGGFLYTTTDIAAAKYRYETLKADRALVFSDSRQAQHMQQAWLITRKAGYVPD
SFSLEHPFFGMMLGKDGKPFKTRSGGTVKLKDLLDEAVERADKLIAERSTELTAEEKAAV
VEAVAIGSVKYSDLSKNRTTDYVFDWDNMLTFEGNTAPYMQYAYTRIRSIFARANIDENA
LSGSIQLNEPKERALAVKLLQFEEALNGVAKEGMPHILCQYLYELAGSFSSFYEACPILN
AEETTKNSRLKLAALTAKTLKQGLDLLGIKTVEKM
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattcaacaaattttatcagataaaattaaacaggcaatggtagcaagcggtgca
gacagcaatgtcgagcctttagtccgccaatcgggcaagccggaatttggcgattaccaa
gccaatggtgcgatgggtgcagcgaaaaaattggggatgaatccgcgtgaatttgcccaa
aaaatcttagagaatgccgatttgaacggtattgccgataaattagaaattgccggtccg
ggctttatcaacattttcttaaacccagaatggctggcggagaacactaacagttcattg
caagcggtcaattttggcataaaaactgcaaatccgcagacgattgtgatcgactactcc
tcgccaaacgtagcaaaagaaatgcacgtcgggcatttgcgttccaccattattggcgat
gcggtagttcgtacccttgcgtttttaggcaataatgtgattcgtgccaaccacgttggc
gactggggtactcaattcggtatgctgatcgcttaccttgaaaaaatggaaaatgagcac
gccagcgaaatggagctaagcgatttagaagccttctatcgtgcggcaaaagagcattat
gattcagacgaagcattcgccgaaaaagcccgtaactatgtggtgaaattacaaagcggc
gataaatattgcttaacaatgtggaaaaaattggtcgatattacaatgcaccacaatcaa
gagaactacaatcgcttaaatgttacgctcaccgaaaaagatgtaatgggcgaaagcctc
tacaatccaatgttgcctgaaattgtggcggatttaaaagccaaaggcttagcggtggaa
gatgacggtgctttagtggttttcctcgatgaatttaaaaataaagatggcgacccaatg
ggcgtaatcgtgcagaaaaaagatggcggtttcttatataccactaccgatattgcggca
gcaaaatatcgctacgagaccttaaaagctgaccgagccttagtcttttctgacagccgc
caagctcaacatatgcaacaggcatggctcattacccgcaaagcgggctatgtgccggac
agtttcagccttgaacacccgttcttcggaatgatgctaggcaaagacggcaaaccgttc
aaaacccgtagcggtggcacagtcaaactcaaagatttattagatgaagcggtagagcgt
gccgataaactgattgccgaacgttcaaccgagctaactgcggaagaaaaagccgccgtg
gttgaagcggttgcgattggttcggtgaaatattctgacttatcgaaaaaccgcaccacc
gattatgtgttcgattgggacaatatgctgacctttgaaggcaataccgccccgtatatg
cagtatgcctacacccgcattcgctccatctttgcccgtgcgaacattgacgaaaatgca
ttgagcggttcaatccaactcaatgagccaaaagagcgtgcattagcagtgaaactattg
caatttgaagaggcattaaacggcgtggcaaaagaaggtatgccacatattttatgccaa
tatttatacgagcttgcaggtagtttctccagtttctacgaggcttgcccgattctcaat
gccgaagaaacaaccaaaaacagccgtttgaaactcgctgccttaacggcgaaaaccttg
aaacaagggttggatttactcggtattaaaactgtagagaagatgtaa

DBGET integrated database retrieval system