KEGG   Mannheimia haemolytica D153: F382_11065Help
Entry
F382_11065        CDS       T02746                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mhae  Mannheimia haemolytica D153
Pathway
mhae00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mhae00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    F382_11065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhae01007]
    F382_11065
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mhae03016]
    F382_11065
   03029 Mitochondrial biogenesis [BR:mhae03029]
    F382_11065
Enzymes [BR:mhae01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     F382_11065
Amino acid related enzymes [BR:mhae01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   F382_11065
Transfer RNA biogenesis [BR:mhae03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    F382_11065
 Prokaryotic type
   Other AARSs
    F382_11065
Mitochondrial biogenesis [BR:mhae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    F382_11065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: AGQ26447
Position
complement(2158488..2160254)
Genome map
AA seq 588 aa AA seqDB search
MMRSHYCGALNRSHLGQTVTLSGWVHRVRNLGRFIFMQIRDHEGIVQVFFDEKDEALFKQ
ASALRSEACVQIQGEVIARDESQINKEMATGEIEVLVKNLVVYNNAEVLPLDFNQNNTEE
QRLKYRYLDLRRPEMAEKLKTRAKITSFVRRFMDDNGFLDIETPMLTKATPEGARDYLVP
SRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFM
TAEEVRALMEAMIHGLWKETLGVDLGKFPMMTWNEAMTRFGSDKPDLRNPLEMVDVADIL
KSVDFKVFSGPANDPKGRVVALRVPNGAALTRKNIDDYTQFVGIYGAKGLAWLKVNDMNT
GLEGIQSPVAKFLNEEVLKALVKRLNLQKDDIVFFGADNWHVATNAIGALRLKVGNDLGL
TDTTAWKPLWVIDFPMFERDDEGNLSAMHHPFTSPKELSPEELVQDPENAVANAYDMVIN
GYEVGGGSVRIFSQQMQQTVFSILGINEEEQKEKFGFLLDALKFGTPPHAGLAFGLDRLT
MLITGTDNIRDVIAFPKTTAAACLMTEAPSYANPKALEELAIRTIPQE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgttctcactactgcggtgcattaaaccgctcacaccttggacaaacagttacc
ttaagcggttgggttcatcgtgttcgtaaccttggtcgttttatttttatgcaaattcgt
gatcatgaaggcattgtgcaggtgtttttcgatgagaaagatgaagcacttttcaagcaa
gcatcggccttacgttctgaggcgtgcgtgcaaattcaaggtgaagtgattgcccgtgat
gaatcgcaaatcaataaagagatggcaaccggtgaaattgaagtgttagtaaaaaattta
gtggtgtataacaacgctgaagtattgccgttagacttcaatcaaaacaataccgaagaa
cagcgtttaaaataccgctatttggatttacgccgccctgaaatggcagaaaagctcaaa
acccgtgctaaaatcaccagttttgtccgccgttttatggacgataacggtttcttagac
attgaaaccccgatgctgaccaaagctactcctgaaggtgcgagagattacctcgtgcca
agccgtgtgcataaaggcaaattctatgctctgccacaatcacctcagctatttaaacag
ttgctaatgatgtcgggcttcgaccgttattaccaaatcgtgaaatgtttccgtgatgaa
gatttgcgtgccgaccgccagccggaatttacccaaatagacgtggaaaccagctttatg
actgccgaagaagtgcgtgcattaatggaagcgatgatccacggcttatggaaagagacc
ttaggcgttgatctcggtaaattcccaatgatgacgtggaatgaagcaatgacccgtttc
ggttcagacaaaccggatttgcgtaacccactggaaatggttgatgtggcagatatttta
aaatcggttgatttcaaagtatttagcggtccggcgaatgatccgaaagggcgtgtagtg
gcacttcgtgtgccaaacggtgcagctctaacccgtaaaaatattgatgactacacccaa
tttgtcggcatttatggggcaaaaggcttggcttggttaaaagtgaatgatatgaacaca
ggtttagaaggcattcaaagcccggttgcaaaattcttaaatgaagaagtgctaaaagcc
ttagttaaacgcttaaacttgcaaaaagacgacattgtattcttcggtgcggataactgg
cacgttgcgactaacgccatcggtgcgttacgcttaaaagtggggaacgatttaggctta
accgataccacagcgtggaaaccgttatgggtgattgatttcccaatgtttgaacgtgat
gatgaaggcaacttatcggcaatgcaccacccgttcacttcaccgaaagaattatcgccg
gaagaattagtgcaagatccggaaaatgcggtggcaaacgcttacgatatggtaattaac
ggctacgaagtgggcggtggctcggtacgtattttcagccagcagatgcaacaaaccgtg
ttcagcattttaggcattaacgaagaagagcaaaaagagaaattcggtttcttattagat
gcgttaaaattcggtactccgccacacgcaggcttagccttcggtttagaccgcttaacg
atgttgattacaggaactgataacattcgtgatgtcatcgctttcccgaaaaccaccgct
gcagcgtgtttaatgacagaagcaccaagctatgcgaatccgaaagcgttggaagagtta
gcaatccgtacaattccacaagagtaa

DBGET integrated database retrieval system