KEGG   Mannheimia haemolytica USMARC_2286: N220_00570Help
Entry
N220_00570        CDS       T02758                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
mhal00051  Fructose and mannose metabolism
mhal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    N220_00570
Enzymes [BR:mhal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     N220_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N ApbA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AGR73915
Position
108542..109681
Genome map
AA seq 379 aa AA seqDB search
MNALHFGAGNIGRGFIGKLLADARIFVTFADINQTQIDQINQNKQYGVKIVGDDSRVEIV
KNIAAINSKDENAVIEQVKNTDLITTAVGPNVLGFIAPLFAKALVARVESGNTQPLNIIA
CENMVRGTTFFKGKIFEHLTAEQQAEIEKVVGFVDSAVDRIVPPAEPNPADPLEVTVEEF
SEWIVDQTQFKGDIPNIKGMELTDNLMAFVERKLFTLNTGHLICAYLGKQAGVKWIKEAI
AIEEIKTQVKATMEESGAVLIKRYGFDPQAHSAYIEKILKRFANPYLNDDVNRVGREPIR
KLSENDRLIKPLRGTLEYGLPYQNLVKGVVMALQYRNEEDPQAVELAEFIANHGVAAAVE
KYTGLTDQAVIAQVVELYQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactccattttggtgccggtaatatcgggcgtggctttatcggcaaattgctt
gctgatgctcgcattttcgtgacttttgccgatattaaccaaactcaaatcgaccaaatc
aaccaaaacaagcaatacggcgtgaaaatcgtgggcgatgacagccgtgtggaaattgtc
aaaaacattgcggcaattaactcgaaagacgaaaatgccgtgattgagcaagtgaaaaac
accgatttaattaccaccgcagtcggcccgaatgtgcttggctttattgccccactgttc
gccaaagcgttagtggctcgtgtggaaagtggcaacacccaaccgctgaacattatcgcc
tgtgaaaatatggtgcgtggcacaactttctttaaaggtaaaatttttgagcatttaact
gccgagcagcaagcagaaattgaaaaagtggttggttttgttgatagtgcggtggacaga
attgtaccacctgccgagccgaaccctgctgatccgttggaagtcacggtggaagagttc
agcgagtggattgtggatcaaacccagttcaaaggtgacattccaaacatcaaaggaatg
gaattaaccgataacctgatggcgtttgtggaacgcaaactgttcaccctgaacaccggg
catttaatctgtgcctacttgggcaaacaagcgggcgtgaaatggattaaagaggcgatt
gcgattgaggaaatcaaaactcaggtgaaagccacaatggaagagagcggtgctgtgctg
attaaacgttacggcttcgacccacaagcccattcagcgtatatcgaaaaaatcctcaaa
cgttttgccaacccgtacttaaacgatgacgtaaaccgtgtagggcgtgagccaatccgc
aaactgagcgaaaacgaccgcttgatcaaaccgttgcgtggcacgttggaatatggctta
ccgtatcaaaacttggtcaaaggcgtggtgatggcattgcaatatcgcaatgaggaagac
ccacaagcggtcgaacttgccgaatttattgcaaatcacggtgtggcggcagcggtggaa
aaatacaccggtttaaccgaccaagcggtcattgctcaagtggtggaattatatcaataa

DBGET integrated database retrieval system