KEGG   Mannheimia haemolytica USMARC_2286: N220_06740Help
Entry
N220_06740        CDS       T02758                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
mhal00020  Citrate cycle (TCA cycle)
mhal00480  Glutathione metabolism
mhal01100  Metabolic pathways
mhal01110  Biosynthesis of secondary metabolites
mhal01120  Microbial metabolism in diverse environments
mhal01200  Carbon metabolism
mhal01210  2-Oxocarboxylic acid metabolism
mhal01230  Biosynthesis of amino acids
Module
mhal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mhal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mhal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N220_06740
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    N220_06740
Enzymes [BR:mhal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     N220_06740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGR75019
Position
1320477..1321724
Genome map
AA seq 415 aa AA seqDB search
MQTQVQIPQGETIQLNQDGSLQVPDNPIIPFIEGDGIGVDVTPAMKAVLDAAVEKAYQGK
RKIAWMEIYAGEKANKLYGENTWLPDETLELIRQYHVAIKGPLMTPVGGGIRSLNVAMRQ
GLDLYNCLRPIRYYDGTPSPVKHPELVDMVIFRENSEDIYAGVEWVAGSPEANKVIEFLQ
QEMGVKKIRFTEDCGIGIKPVSKQGTQRLVRAALQYVIDNNRKSLTLVHKGNIMKFTEGA
FKEWGYQVAEEFGAKLIDKGPWMSLTNPKTGEEIIIKDSIADAFLQEILLHPTEYDVIAT
LNLNGDYISDALAAQVGGIGISPGANIGFEAAIFEATHGTAPKIAGQNKGNPGSLILSGE
MMLRHLGWVEAADLVVKAVSKTIANKTVTFDFAEMLEGVTLRSTSEFAQDIIANM
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacaagtccaaattccacaaggcgaaactattcaactgaaccaagacggttct
ttacaagttccggataatccgattattccatttattgaaggtgacggcatcggtgttgat
gttactcctgcaatgaaagcagtgctagatgcggcggtagaaaaagcctatcaaggcaag
cgaaaaattgcttggatggaaatttacgcaggcgaaaaggcgaataaattatatggtgag
aacacttggttgccggatgaaaccttagagcttatccgccaatatcacgtggcgattaaa
ggtcctttaatgacaccggtgggtggcggtattcgttctttaaatgtggcgatgcgtcaa
ggattagatttatacaactgcttacgcccaattcgttattatgacggtacgccaagcccg
gttaaacaccctgagctggtggatatggtgattttccgtgaaaactcggaagatatttat
gccggtgtagaatgggttgccggttcgcctgaagccaataaagtgatcgaatttttacaa
caagagatgggcgtgaaaaaaatccgctttaccgaagattgcggtatcggaattaagccg
gtttctaagcaaggcacacaacgcttggtgcgtgctgcattgcaatatgtaattgataac
aaccgtaaatcgctcacgcttgtgcataaaggtaacattatgaaatttaccgaaggagca
tttaaagagtggggctaccaagttgcggaagaatttggggcaaaattaattgataaaggc
ccttggatgagcttgactaatccgaaaaccggtgaggaaatcattataaaagacagcatt
gccgatgcctttttacaagaaatcttgttacacccaaccgaatatgatgtgattgctaca
ctgaacctaaacggcgactatatttctgatgctttagccgcacaagtaggcggaatcggt
atttcaccgggagcgaatattgggtttgaagcggctatttttgaagccacacacggcaca
gcccctaaaattgcagggcaaaataaaggcaatcctgggtcattaattttaagtggggaa
atgatgttacgccatttaggttgggttgaagcggctgatttagtggtaaaagcggtgtct
aaaaccattgccaataaaactgtcacctttgattttgcggaaatgctggagggggtaact
ctacgctcaacctcagaatttgcacaagacattattgccaatatgtaa

DBGET integrated database retrieval system