KEGG   Mannheimia haemolytica USMARC_2286: N220_10060Help
Entry
N220_10060        CDS       T02758                                 

Definition
(GenBank) hypothetical protein
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
mhal00010  Glycolysis / Gluconeogenesis
mhal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N220_10060
Enzymes [BR:mhal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     N220_10060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 RecQ_Zn_bind
Motif
Other DBs
NCBI-ProteinID: AGR75623
Position
complement(1902588..1903265)
Genome map
AA seq 225 aa AA seqDB search
MRYFAKHWYKTTACLTTIFTAFPLFAQPIENIPTSHYELEKIIIFSRHGLRSPLTEKGSD
LEKSTPYKWANWSVPTGHLTHKGTLLETYFGQYLGQWLTHNGLLDKASCESGKQIEVYAN
SLQRTIGTAQALVAGGFSGCNVQVKHHQQIGKMDPVFNPIIRSDDQTFVQTALSKIDLNK
THQYLAPSYHLLSEIIDYAHSEKCLQEKQCEFFNDVGKLRIKKDK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcgttattttgcaaaacattggtataaaactaccgcttgtctgacaacaattttcaca
gcatttcctctttttgctcaaccaattgaaaatataccaacttcccactacgaattagaa
aaaatcattatatttagccgacacgggttacgttcccctcttacagaaaaaggcagtgat
ttagaaaaatcaaccccttataaatgggcaaattggagtgtaccgaccggtcatttaacc
cataaagggacgctgttggaaacctattttgggcagtatcttggtcaatggctcacacat
aatgggttattggacaaggcaagctgtgaaagtgggaagcagattgaggtttatgctaat
agcctgcaacgtacaattggcactgcacaagctttggttgccggtgggttttcaggttgt
aatgtacaagttaaacaccaccagcagattggaaagatggatccggtgtttaatccaatt
attcgctccgatgaccagacatttgtgcaaacagcattaagcaaaattgacctcaataaa
acccatcagtatttagcgccatcctatcatttattaagcgaaataatcgattatgctcat
tcagaaaaatgtttgcaggaaaaacagtgtgaattttttaatgatgttggtaaattaagg
attaaaaaggataaataa

DBGET integrated database retrieval system