KEGG   Mannheimia haemolytica D171: J450_01130Help
Entry
J450_01130        CDS       T02747                                 

Definition
(GenBank) ATPase
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
mham  Mannheimia haemolytica D171
Pathway
mham02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mham00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J450_01130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mham01001]
    J450_01130
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mham02022]
    J450_01130
Enzymes [BR:mham01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     J450_01130
Protein kinases [BR:mham01001]
 Histidine kinases
  OmpR family
   J450_01130
Two-component system [BR:mham02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   J450_01130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS HATPase_c_2 HATPase_c_3 HATPase_c_5 PAS_9 PhoR PAS_8
Motif
Other DBs
NCBI-ProteinID: AGQ37812
Position
261139..262419
Genome map
AA seq 426 aa AA seqDB search
MKVKLSLKHFLLELLLAAAVAGVFNLFFPAYFFWFSFCLLVLLIWHHHTESSLLQLLRPN
EQSGRSKVTTMEHLSQSAAFYHERLRQDKIKTLRLLSKLNKHIQYLPDAIIICQENGEIS
WCNNVAQELFEFYWDKKSNKSIFNVIFYPEFKSYFRQQRHHRPLVLLTHNKRYIELNLNR
YDSNSRLIVARDVTSFVRLMHSRQTFLANMNHELRTPLTILQGYLEMLENEPHNMALQQK
ALNAMKEQSQRMTNLLRQLSLLVKIEHSNDSEHNEVQMSALISAIQKNTEILSQNQQILF
DIEPNLTVWGDQEQLQSAVSNLIYNAIRHAGEGVTIQICCQRDNQEPNTAIFSVQDDGIG
IDAHHITHLTERFYRVDESRSNKTGGSGLGLAIVKHALEQHHSTLEIESEAGKGSRFSFK
LPLIKK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaagctctcacttaaacactttttattggaacttttgctggcagcagccgtt
gccggcgtattcaatctgtttttccctgcttattttttctggtttagtttttgtttactg
gttctacttatttggcatcaccacaccgaatcttctctccttcagttactcagacctaat
gagcaaagcggcaggtcaaaagtaacgacaatggagcatttatctcaaagtgccgcattc
tatcacgaacgtttacgccaagataaaatcaaaaccttacgtctgttatcaaaattaaat
aagcatattcaatacttacccgatgcgatcattatttgccaagaaaacggggagatttct
tggtgcaataatgttgcacaagagctatttgagttttattgggacaaaaaatcaaataaa
agcatttttaatgtgattttttatcctgaatttaaaagctatttccgccaacaacgacac
catcgcccattggtactgctgactcataataaacgctatattgaattgaatctcaatcga
tatgacagtaactccagacttattgtcgcacgagatgtaacctcttttgtccgccttatg
cactcacgacaaacctttttggcaaatatgaaccacgaactgcgaacgcctcttaccata
ttacaaggttatttggaaatgctggaaaacgagccgcataatatggcattacagcaaaaa
gcgctcaatgcgatgaaagagcaaagtcaacgtatgactaacctgcttcgccaactctca
cttttggttaaaatcgagcattccaatgattccgaacacaatgaggtccagatgtcggcg
ttaatctccgccatacaaaaaaataccgagattttaagccaaaatcagcaaatactgttt
gatattgagcctaatttaacggtatggggagatcaagagcaactccaaagcgctgtatca
aatttaatttacaatgcaatacggcacgccggtgaaggagttaccattcaaatatgttgt
caacgtgataatcaagagccgaatactgcgattttcagcgtgcaagatgacggtattggt
atcgatgcccatcatattacccatctgacagaacgtttctatcgtgtggacgaatctcgt
agcaacaaaaccggcggtagcggtttaggtctggctattgtcaaacacgctcttgaacag
caccattccacactggaaattgaaagtgaagccggtaaaggaagcagatttagttttaaa
ctacctctaataaaaaaatag

DBGET integrated database retrieval system