KEGG   Mannheimia haemolytica D171: J450_05210Help
Entry
J450_05210        CDS       T02747                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
mham  Mannheimia haemolytica D171
Pathway
mham00030  Pentose phosphate pathway
mham00480  Glutathione metabolism
mham01100  Metabolic pathways
mham01110  Biosynthesis of secondary metabolites
mham01120  Microbial metabolism in diverse environments
mham01130  Biosynthesis of antibiotics
mham01200  Carbon metabolism
Module
mham_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mham_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mham00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    J450_05210
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    J450_05210
Enzymes [BR:mham01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     J450_05210
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     J450_05210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 2-Hacid_dh_C F420_oxidored Shikimate_DH NAD_binding_11 IlvN 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGQ38545
Position
complement(1101543..1102997)
Genome map
AA seq 484 aa AA seqDB search
MSQKGDIGVIGLAVMGQNLILNMNDNGFKVVAYNRTTSKVDEFLEGAAKGTNIIGAYSLE
DLAAKLEKPRKVMLMVRAGEVVDQFIEALLPHLEEGDIIIDGGNSNYPDTNRRVKALAEK
GIRFIGSGVSGGEEGARHGPSIMPGGDESAWQYVKPIFQAISAKTDKGEPCCDWVGRDGA
GHFVKMVHNGIEYGDMQLICEAYQFLKDGLGLSYDEMHEIFKEWKNTELDSYLVDITTDI
LAYKDEDGEPLVEKILDTAGQKGTGKWTGINALDFGIPLTLITESVFARCVSAFKDQRVA
ASRLFNKEIGKVEGDKKVWVEAVRRALLASKIISYAQGFMLIREASEQFGWDINYGNTAL
LWREGCIIRSRFLGNIRDAYEANPYLVFLGSDPYFKDILENCLADWRKVVAKSVEIGLPV
PCMASAITFLDGYTSARLPANLLQAQRDYFGAHTYERTDKARGEFFHTNWTGRGGNTAST
TYDV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaaaggcgatatcggcgtgattgggctcgccgtaatgggtcaaaatttaatt
ttgaatatgaatgacaacggctttaaagtggtggcgtacaaccgcactacttcaaaagtg
gatgagttcttagaaggtgcggcgaaaggcacgaacattatcggtgcttactcgttagaa
gatttagcggcgaagttggaaaaaccgcgtaaagtgatgctaatggtgcgtgccggtgag
gtggtggatcagtttatcgaggctcttctgccacatttagaagaaggcgacatcatcatt
gatggcggtaactcaaactatccggacaccaaccgccgtgtgaaagcgttagcggaaaaa
ggcattcgctttatcggctcaggtgtatcgggcggcgaagagggtgctcgtcacggaccg
tcaattatgccgggcggtgatgaatctgcgtggcaatatgtgaagccgattttccaagca
atttcagccaaaaccgacaaaggtgagccttgttgtgactgggttggtcgtgatggagca
gggcattttgtgaaaatggttcacaacggtatcgaatatggcgatatgcagttaatttgt
gaagcctaccaattcttaaaagatggtttaggtttaagctatgatgaaatgcacgaaatc
tttaaagagtggaaaaacaccgaattagacagctatttggtggatattaccactgatatt
cttgcctacaaagacgaagacggcgagccattggtagagaaaattctcgacaccgcaggt
caaaaaggaacgggtaaatggactggtattaacgcccttgatttcggcattccattaaca
ctgattaccgagtcggtattcgcccgttgcgtatctgcgtttaaagatcaacgtgttgcg
gcttcaagattgtttaacaaagaaattggtaaagttgaaggcgacaaaaaagtatgggta
gaagcggtacgccgtgcgttacttgcttccaaaatcatctcttatgcacaaggctttatg
ttgattcgtgaggcttctgagcaattcggttgggacatcaactacggcaataccgcccta
ttatggcgtgaaggttgtattatccgcagccgtttcttaggcaacattcgtgatgcgtat
gaagccaacccatatttagtgttcttaggctcagacccatacttcaaagatattttggaa
aactgcttggcagattggcgtaaagtagtggcaaaatcggtggaaatcggtttacctgta
ccttgtatggcgtcagccattaccttcttagatggctacacctcggcacgtttaccggca
aacttactccaagcacaacgtgactactttggtgctcatacttatgagcgtacagacaaa
gctcgcggtgagttcttccacaccaactggacaggacgtggcggtaataccgcatcgacc
acttatgatgtataa

DBGET integrated database retrieval system