KEGG   Mannheimia haemolytica D171: J450_09860Help
Entry
J450_09860        CDS       T02747                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mham  Mannheimia haemolytica D171
Pathway
mham00670  One carbon pool by folate
mham01100  Metabolic pathways
mham01120  Microbial metabolism in diverse environments
mham01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mham00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    J450_09860 (metF)
Enzymes [BR:mham01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     J450_09860 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR DUF4252
Motif
Other DBs
NCBI-ProteinID: AGQ39397
Position
2049380..2050162
Genome map
AA seq 260 aa AA seqDB search
MLWDSIDRLSPLKPKFVSVTYGANSGERDRTHSIVKSIQEKTGIISAPHLTGIDATPEEL
KVIAKDYWDSGIRRIVALRGDIPKGYDKALFYASDLVALLKSVADFDISVAAYPEVHPEA
KSAQADLLNLKRKIDAGANHVITQFFFDVESYLRFRDRCVSIGIDCEIVPGILPVTNFKQ
LQKMAAVTNVKIPTWMGKMYEGLDDDQTTRNLVAASIAMDMVKVLSREGVNDFHFYTLNR
SELTYAMCHTLGVRPDLTTA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgggattctattgatcgcctaagtcctttaaaaccgaaatttgtttcggtaact
tatggagcaaattctggtgagcgagatcgtacacacagtattgtgaaatcaatccaagaa
aaaacagggatcatttcagctccgcacttaacaggcattgatgcaacaccggaagaatta
aaggtaattgccaaagattattgggatagtggtattcgccgaattgttgctttgcgtggc
gatataccgaaaggttatgataaagcactattttacgcctcagatttagtcgctttatta
aaatcagtagcagatttcgatatttccgtggctgcctaccctgaagttcaccctgaagca
aaatcagcacaggcagatttacttaacttgaaacgtaaaatcgatgcgggtgcaaaccac
gttattacgcaattcttttttgatgtagagagttatttacgttttcgtgatcgctgtgtt
tctattgggattgattgtgaaattgtgccgggtattctgccggtgacaaatttcaagcag
ttgcaaaaaatggcagcagtgactaatgttaagatcccgacttggatgggtaaaatgtac
gaagggttagatgatgatcaaaccaccagaaacttagttgcagcaagtattgcaatggat
atggtgaaagtgctttctcgtgaaggggtgaatgatttccacttctataccttaaatcgt
agtgaactcacttatgcaatgtgccatactttaggcgtaagacctgatttaacgactgca
taa

DBGET integrated database retrieval system