KEGG   Mannheimia haemolytica D174: J451_03455Help
Entry
J451_03455        CDS       T02748                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
mhao  Mannheimia haemolytica D174
Pathway
mhao00860  Porphyrin and chlorophyll metabolism
mhao01100  Metabolic pathways
mhao01110  Biosynthesis of secondary metabolites
Module
mhao_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:mhao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    J451_03455
Enzymes [BR:mhao01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     J451_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C GFRP
Motif
Other DBs
NCBI-ProteinID: AGQ40578
Position
complement(650865..652232)
Genome map
AA seq 455 aa AA seqDB search
MSEIIWDLALIQKYNHSGPRYTSYPTALEFNENYTNEDFIRAAARYPERPLSLYVHIPFC
HKLCYFCGCNKVITRHRHKVEIYLDYLEREIKTRAPLFQNRLVTQIHWGGGTPTYLDEDQ
SARLMQMLRANFDVSDDAEISIEMDPREIELSMLDHLRAIGFNRLSMGIQDFDKEVQRLV
NREQDEEFIFALMKRAKELGFVSTNVDLIYGLPKQNVESFMYTLKRVVELNPDRMSVFNY
AHLPSRFAAQVKIKEELLPAPETKLTILQNSIEFLGKNGYKFIGMDHFAKPDDELAIAQE
KGILHRNFQGYTTQEECDLLGMGVSAISLLGDTYAQNRKELQQYYADVETNGIALHKGIA
LTQDDCIRRDVIKALICNFKLDFATIEKQYGIDFKRYFAEDLAFLAPLAEDELLTMNDDS
IVVSPRGRLLIRNICLCFDVYSRQLARRQQFSRII
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaattatttgggatttagcccttattcaaaaatataaccattcagggcctcgt
tatacctcttacccaacagcgttggagtttaacgaaaattacaccaatgaagattttatt
cgtgctgcagctcgttaccctgagcgtccgctttcgctttatgtgcatattccgttttgc
cataaactgtgctatttctgtggctgtaataaagtgattactcgtcatcgccataaagtt
gaaatttatttagattatttagagcgtgaaattaaaactcgcgcacctctgtttcaaaat
cgtttagtgacccaaatacactggggtggcggtacgccgacttatttagacgaagatcaa
tcggcacgtttaatgcaaatgctacgagccaattttgatgtgagcgatgatgcggaaatc
agcattgaaatggatccgcgtgaaatcgaattaagtatgttggatcacctgcgtgctatc
ggttttaaccgtctgagtatgggtattcaggatttcgataaagaagtgcaacgtttggtg
aatcgtgagcaagatgaagagtttatttttgccttgatgaaacgggcaaaagaacttggt
tttgtttcaactaatgtggatttgatttacggcttgccaaaacagaatgtggaaagcttt
atgtacaccttaaaacgtgtggtagagctaaaccctgatcgtatgagcgtatttaactat
gcccacttgccaagccgttttgctgcacaagtgaaaattaaagaagagttgttgccggct
ccggaaaccaaattgacgattttgcaaaattccatcgaatttttaggcaaaaacggttat
aagtttatcggtatggatcactttgctaaacctgatgatgagttagctattgcacaagaa
aaaggcattttacaccgtaacttccaaggctataccactcaagaagagtgtgatttattg
ggaatgggcgtatcggcaatcagcttactcggcgatacttacgcccaaaaccgcaaagaa
ttacaacaatactatgctgatgttgaaaccaacggtattgcgttgcataaaggcattgcg
ttaacccaagatgattgcattcgccgtgatgtgataaaagccttgatttgtaatttcaaa
ttagattttgccaccattgaaaagcaatatggtattgattttaaacgttattttgccgaa
gatttagctttcttagcgccgttggcggaagatgaattattaacgatgaatgacgacagc
attgtggtttccccacgagggcgtttattgatccgtaatatttgcttatgctttgatgtc
tattcaagacaattagcgagaagacagcagttttcccgtattatttaa

DBGET integrated database retrieval system