KEGG   Mannheimia haemolytica D174: J451_04195Help
Entry
J451_04195        CDS       T02748                                 

Definition
(GenBank) hypothetical protein
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
mhao  Mannheimia haemolytica D174
Pathway
mhao00010  Glycolysis / Gluconeogenesis
mhao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    J451_04195
Enzymes [BR:mhao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     J451_04195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 DnaGprimase_HBD
Motif
Other DBs
NCBI-ProteinID: AGQ40713
Position
complement(794375..794941)
Genome map
AA seq 188 aa AA seqDB search
MRLSKNIVDALLLQYYEGFPLKEIANNQLDSDQKWQTLNKIKNDYQFMLRGDPFIAKHIS
LPLLKYIQQDLNSENKITLLVGHDSNIIALLSALNVKPYKLAHQYEQTPIGGKVFIEIWK
EKSSQAQKVKLEYVYQSTDQIRKAIPLSLDKPPQHHILSLDYCQADQYGLCDYMEFKQLL
EKVIADTL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcgattaagtaaaaatattgtcgatgccttattgctgcaatattatgaaggttttcct
ttaaaagagattgcaaataaccagcttgatagtgatcagaaatggcaaacactcaataaa
attaaaaacgattaccaatttatgctacgaggagatccatttattgctaaacatatttca
ttaccgctattaaaatatattcagcaagatttaaatagtgaaaataaaataacactttta
gtcggacacgattccaatattatagccttactttctgcattaaatgttaagccttataaa
ttagcacatcaatatgaacaaactccaataggagggaaagtctttattgaaatctggaaa
gaaaaaagtagccaagcacaaaaagttaaactggaatatgtatatcaatctactgaccaa
attcgtaaagcgattccactaagccttgataaaccaccgcaacatcacattttgagtttg
gattattgccaagctgaccaatatggattatgcgattatatggaatttaaacagttactg
gaaaaagtcattgctgatacattgtga

DBGET integrated database retrieval system