KEGG   Mannheimia haemolytica 89010807N: WC39_13700Help
Entry
WC39_13700        CDS       T03749                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
mhaq  Mannheimia haemolytica 89010807N
Pathway
mhaq00620  Pyruvate metabolism
mhaq00630  Glyoxylate and dicarboxylate metabolism
mhaq01100  Metabolic pathways
mhaq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WC39_13700
   00630 Glyoxylate and dicarboxylate metabolism
    WC39_13700
Enzymes [BR:mhaq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     WC39_13700
    1.2.1.22  lactaldehyde dehydrogenase
     WC39_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 Phage_ABA_S OmdA
Motif
Other DBs
NCBI-ProteinID: AKA12777
Position
2693313..2694755
Genome map
AA seq 480 aa AA seqDB search
MKQHKMYINGEFVPALDGRTLAVYNPATEKAISEVPRGGADDAKIAIDAAEAAQEAWERL
PAIERGKYLRQIAVGIRERADEIARTISEEMGKTLSLATVEVHFTADYLDYMAEWARRYE
GEIIQSDRPNEHIFLYKKAIGVTTGILPWNFPFFLIARKAAPALVTGNTIVIKPSEDAPN
NAILFSEIVHQVGLPKGVFNVVTGYGNEVGPELSGNEKIGMVSFTGSQFAGQKVMEAASK
NIIKVNLELGGKAPAIVLDDADLELAATAVVNSRIINSGQVCNCAERIYVQSSIKEQFVQ
KLVEKMQAVKYGNPLEQQDIDMGPMVNEKGLHKVQEMVTHALHQGGNLVLGGNVVEGTGY
YFEPTIIDNVDNSMDIMRHEIFGPVIPVATFDTIDEAIRLANDCEYGLTSSVYTQNINKA
MKVISRLKFGETYVNRENFEAMQGYHAGWRKSGIGGADGKHGLEEYLQTQVVYLQFDDKV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaacataaaatgtatattaatggtgaatttgtgcctgcgttagatggtcgcact
ttagcagtctataaccctgccaccgaaaaagctatctccgaagtccctcgtggcggagct
gatgatgccaaaatcgctatcgatgctgctgaagccgcccaagaagcttgggaacgttta
ccagcgattgaacgaggaaaatatttacgtcaaattgctgtggggattcgtgagcgtgcc
gatgaaattgctcgcactatttccgaagaaatgggtaaaactctgtccttagcaaccgtt
gaggtacattttaccgctgactacttagactatatggcagaatgggcgagacgttatgaa
ggggaaattatccaaagtgatcgcccaaatgaacatattttcctatacaaaaaagcgatt
ggcgtcaccaccggcattttaccttggaacttcccgttcttcctcattgcccgtaaagcg
gctccggcattagtaacaggtaatactattgtgattaaaccgagtgaagatgcacctaat
aatgcgattctcttttcggaaatcgtgcatcaagtcggtttacctaagggggtatttaat
gtcgtcaccggctatggcaatgaagtcgggccggaactttcaggcaatgaaaaaatcggt
atggtttcctttaccggtagccagtttgccggacaaaaagtgatggaagccgccagcaag
aatatcattaaagtcaatttggaattgggcggaaaagcaccggctatcgtattagacgat
gcagatcttgagcttgctgctaccgctgtagtaaattctcgaatcatcaattcaggacag
gtttgtaactgtgcagaacgcatttatgtacagagttcaattaaagagcaatttgtccaa
aaattggtagagaaaatgcaagcggtgaaatatggtaatccattagaacaacaagacatt
gatatggggccgatggtaaatgaaaaaggcttgcataaagtgcaggaaatggtgacacac
gcactgcatcaaggaggtaatctggtattaggtggtaacgtggttgaaggaacaggctac
tactttgagccaactattatcgacaatgtagataactctatggatattatgcgtcacgaa
atttttggtccggtcattccggttgcgacatttgataccattgatgaagcgattcgctta
gccaatgattgtgaatatggcttaacctcttcggtttacacgcaaaatatcaataaagcg
atgaaagtaatttcccgcttaaaattcggagaaacttatgtaaaccgtgaaaactttgaa
gcaatgcaaggctaccacgccggttggcgtaaatcgggtattggcggtgctgacggtaag
cacggcttagaggaatacctacaaactcaggtggtttatctgcaatttgatgataaagta
tag

DBGET integrated database retrieval system