KEGG   Mycolicibacterium hassiacum: MHAS_00765Help
Entry
MHAS_00765        CDS       T05715                                 

Definition
(GenBank) Putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mhas  Mycolicibacterium hassiacum
Pathway
mhas00010  Glycolysis / Gluconeogenesis
mhas00071  Fatty acid degradation
mhas00280  Valine, leucine and isoleucine degradation
mhas00310  Lysine degradation
mhas00330  Arginine and proline metabolism
mhas00340  Histidine metabolism
mhas00380  Tryptophan metabolism
mhas00410  beta-Alanine metabolism
mhas00561  Glycerolipid metabolism
mhas00620  Pyruvate metabolism
mhas00625  Chloroalkane and chloroalkene degradation
mhas00903  Limonene and pinene degradation
mhas01100  Metabolic pathways
mhas01110  Biosynthesis of secondary metabolites
mhas01120  Microbial metabolism in diverse environments
mhas01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mhas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHAS_00765
   00053 Ascorbate and aldarate metabolism
    MHAS_00765
   00620 Pyruvate metabolism
    MHAS_00765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MHAS_00765
   00561 Glycerolipid metabolism
    MHAS_00765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MHAS_00765
   00310 Lysine degradation
    MHAS_00765
   00330 Arginine and proline metabolism
    MHAS_00765
   00340 Histidine metabolism
    MHAS_00765
   00380 Tryptophan metabolism
    MHAS_00765
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MHAS_00765
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MHAS_00765
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MHAS_00765
Enzymes [BR:mhas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MHAS_00765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: VCT89079
UniProt: A0A3P3ZUF4
Position
1:complement(810538..812004)
Genome map
AA seq 488 aa AA seqDB search
MNHEPRMLIDGKLVESESGRRFDVINPATEEVIGTAADGTRADMERAVAAARRAFDTTDW
SRNHAFREACLRQLQAALEAEREEIRGELIAEVGCPLLSTYGPQLDAPLSEAITWPADMI
SQFPWKRELPDKDAFGMGALSAREVWKEPVGVVGVIVPWNFPLEITLNKIGPILAMGNTC
VVKPAPDTPFNATRLGRLIAEKTDIPPGVVNIVPASDHLVGEVLSTSPLVDMVAFTGSTA
TGRRIMSAASATLKRTFLELGGKSVYLILDDDGDISGPIEGSAFVCMHAGQGCAMPTRLL
VPNSRYDEAVEIVTAAMQRTKYGDPTDPSVIQGPLISKRQHERVLGYIEKGKQEGARLTT
GGRVPPELTKGFFVEPTVFANVDNRMTIAQEEIFGPVLSVIGFDDDDDAVRIANDSIYGL
SGVVHARDLDRAKAVAARIRTGTLGINGSVWYGADAPFGGYKQSGVGRQCGIEGLEIFTE
TKTVSWPA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgaaccccgcatgctcatcgacggcaagctcgtcgagtccgaatccggccgt
cgcttcgacgtcatcaacccggcgaccgaggaggtcatcggcaccgcggccgacggcacc
cgcgccgacatggaacgcgcggttgccgcggcgcgccgcgccttcgacaccaccgactgg
tcccgcaaccacgcgttccgcgaggcgtgcctgcgccagttgcaggccgcgctggaagcc
gaacgcgaggagatccgcggcgagctgatcgccgaggtcggctgcccgctgctgagcacc
tacggcccgcagctcgacgccccgctcagcgaggcgatcacctggccggccgacatgatc
agccagttcccctggaagcgcgaacttcccgacaaggacgcgttcgggatgggtgcgctg
tcggcccgcgaggtgtggaaggaaccggtcggcgtggtcggggtgatcgtgccgtggaac
ttcccgctggagatcacgctcaacaagatcgggccgatcctggcgatgggcaacacctgc
gtggtcaagcccgccccggacaccccgttcaacgccacccggctcggccggttgatcgcc
gagaagaccgacatcccgcccggcgtggtcaacatcgtgccggcctcggaccatctcgtc
ggcgaggtgctgtcgacctccccgctggtcgacatggtggccttcaccggttccaccgcc
accggccggcgcatcatgtcggcggcgtcggccacgctgaaacgcaccttcctcgaactc
ggcggcaagtcggtctatctgatcctcgacgacgacggcgacatctccggtccgatcgag
ggcagcgcgttcgtgtgcatgcacgccggccagggctgcgcgatgccgacccggctgctg
gtgccgaactcccgctacgacgaggcggtcgagatcgtgaccgcggcgatgcagcggacc
aagtacggcgatccgaccgatccgtcggtgatccaggggccgctgatctccaagcgccag
cacgagcgggtgctcggctacatcgagaagggcaagcaggagggggcccggctgaccacc
ggcggccgggtgccgccggagttgaccaagggcttcttcgtcgaacccacggtgttcgcg
aacgtcgacaaccggatgaccatcgcccaggaggagatcttcgggccggtgttgtcggtg
atcggcttcgacgacgacgacgatgcggtgcggatcgccaacgactccatctacggcctc
tccggcgtcgtgcacgcccgcgacctcgaccgcgccaaggcggtggcggcgcggattcgc
accggaacgctcggcatcaacgggagcgtctggtacggcgccgacgcgccgttcggcggc
tacaagcagtccggtgtcggccgtcagtgcggcatcgaggggctggagatcttcaccgag
acgaagacggtcagctggcccgcatag

DBGET integrated database retrieval system