KEGG   Mycolicibacterium hassiacum: MHAS_02663Help
Entry
MHAS_02663        CDS       T05715                                 

Gene name
murI
Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
mhas  Mycolicibacterium hassiacum
Pathway
mhas00471  D-Glutamine and D-glutamate metabolism
mhas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MHAS_02663 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhas01011]
    MHAS_02663 (murI)
Enzymes [BR:mhas01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     MHAS_02663 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:mhas01011]
 Precursor biosynthesis
  Racemase
   MHAS_02663 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: VCT90953
UniProt: K5BD52
Position
1:complement(2828903..2829730)
Genome map
AA seq 275 aa AA seqDB search
MTDALAPVGIFDSGVGGLTVARAIIDQLPDEDIIYIGDTANGPYGPLTIPQIRAHALAIG
DELIGRGVKALVIACNTASAACLRDARERYAPVPVVEVILPAVRRAVAATRNGRIGVIGT
EATIASGAYQDAFAAARDIEVFAVACPRFVDFVERGVTSGRQVLGLAEGYLEPLQRAEVD
TLVLGCTHYPMLSGLIQLAMGDHVTLVSSAEETAKDLLRVLTERDLLHPHPDQPGVTARR
RYESTGDPEAFTRLAARFLGPTVEGLVHHHVPGRR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcgctggctccggtcgggatcttcgattccggtgtcggcggcctcaccgtc
gcccgcgccatcatcgaccagctgcccgacgaggacatcatctacatcggcgacaccgcc
aacggcccgtacggtccgttgaccattccgcagatccgcgcgcacgcgctggccatcggg
gacgaactgatcggccgcggggtcaaggcgctggtgatcgcgtgcaacaccgcctcggcg
gcctgcctgcgcgacgcgcgggagcgctacgcgccggtgccggtggtggaggtgatcctg
cccgcggtccggcgcgcggtggccgccacccgcaacgggcgcatcggcgtcatcggcacc
gaggccacgatcgcgtcgggtgcctaccaggacgcgttcgccgccgcgcgcgatatcgag
gtgttcgcggtggcctgcccgcggttcgtcgacttcgtcgagcgcggggtgaccagtggc
cgtcaggtgctagggctggccgagggatacctggagccgctccaacgcgccgaggtggac
accctggtactgggttgcacccactacccgatgttgtcaggactgatccagctggcaatg
ggcgaccacgtgacgctggtgtccagcgccgaggagaccgccaaggacctgctgcgggtg
ctcaccgaacgcgatctgctgcatccgcaccccgaccagcccggcgtcaccgcgcgccgc
cgctacgagtccaccggcgacccggaggcgttcacccggctcgccgcgcgattcctcgga
ccgaccgtcgagggtcttgtccaccatcacgtccctggccgaagatga

DBGET integrated database retrieval system