KEGG   Mycolicibacterium hassiacum: MHAS_03062Help
Entry
MHAS_03062        CDS       T05715                                 

Gene name
ald_5
Definition
(GenBank) 3-succinoylsemialdehyde-pyridine dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mhas  Mycolicibacterium hassiacum
Pathway
mhas00010  Glycolysis / Gluconeogenesis
mhas00071  Fatty acid degradation
mhas00280  Valine, leucine and isoleucine degradation
mhas00310  Lysine degradation
mhas00330  Arginine and proline metabolism
mhas00340  Histidine metabolism
mhas00380  Tryptophan metabolism
mhas00410  beta-Alanine metabolism
mhas00561  Glycerolipid metabolism
mhas00620  Pyruvate metabolism
mhas00625  Chloroalkane and chloroalkene degradation
mhas00903  Limonene and pinene degradation
mhas01100  Metabolic pathways
mhas01110  Biosynthesis of secondary metabolites
mhas01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHAS_03062 (ald_5)
   00053 Ascorbate and aldarate metabolism
    MHAS_03062 (ald_5)
   00620 Pyruvate metabolism
    MHAS_03062 (ald_5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MHAS_03062 (ald_5)
   00561 Glycerolipid metabolism
    MHAS_03062 (ald_5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MHAS_03062 (ald_5)
   00310 Lysine degradation
    MHAS_03062 (ald_5)
   00330 Arginine and proline metabolism
    MHAS_03062 (ald_5)
   00340 Histidine metabolism
    MHAS_03062 (ald_5)
   00380 Tryptophan metabolism
    MHAS_03062 (ald_5)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MHAS_03062 (ald_5)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MHAS_03062 (ald_5)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MHAS_03062 (ald_5)
Enzymes [BR:mhas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MHAS_03062 (ald_5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: VCT91348
UniProt: K5B9V5
Position
1:complement(3250321..3251817)
Genome map
AA seq 498 aa AA seqDB search
MTASSVTAANVRFNPETRLYIDGRLRDSATGKTVDNINPATEEVLGVATDAGAEDMEEAI
AAARRAFDTTDWSTNHEFRRRCLMQLHEALQQEKEDIRAELIAEVGATVGMTAIAQLEWP
LADAVRWPAQYISEFAWERPLPDSNLMGIPCHRKVVKEPMGVVGAITPWNFPFEIISNKL
GQALATGNTVVLKPAMETPWSALRWGRIIAEKTDIPPGVVNIVPTSDNSIAQRLATDPRV
DMVSFTGSTAVGRLIQNLSGDTMKRNMLELGGKSAYLLLDDADLDTALPGCVGALMHAGQ
GCALTTRMLVPRKFYDQAVEVATATFGAIPVGDPADPNVFCGPLVSAKQRDRVLNYIEIA
KREGGRITVGGGAPDGLDRGYFVAPTVIADVEPHHTVFQEEIFGPVLTITPYDGGDDEAV
ALANNSTYGLAGAVFGSPERAMAVARRIRTGSMMVNGALYYGADAPFGGYKMSGIGRQNG
HEGFEQYLQTKTIAYPIS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacggcttcatctgttaccgcagcgaacgtacggttcaaccccgagacccggctgtat
atcgacggccggctgcgggattcggcaacgggcaagaccgtcgacaacatcaacccggcc
accgaggaggtgctgggcgtcgccaccgacgccggtgccgaggacatggaggaggcgatc
gccgcggcgcggcgcgccttcgacaccaccgactggtccaccaaccacgagttccgccgg
cgctgcctgatgcagctgcatgaggcgctgcagcaggagaaggaggacatccgcgccgag
ctgatcgccgaggtcggcgcgacggtcgggatgacggcgatcgctcagctggagtggccg
ctggccgacgcggtgcgctggcccgcacagtacatctccgagttcgcctgggagcgtccg
cttccggacagcaacctgatgggcatcccctgccaccgcaaggtggtcaaggagccgatg
ggggtggtcggcgcgatcacgccgtggaacttcccgttcgagatcatcagcaacaagctg
ggccaggccctggccaccggcaacaccgtggtgctcaagccggccatggagaccccgtgg
agcgcgctgcgctggggccggatcatcgccgagaagaccgacatcccgccgggcgtggtc
aacatcgtgccgacctcggacaacagcatcgcccagcggctggccaccgacccgcgggtg
gacatggtctcgttcaccgggtcgaccgcggtcggcaggctgatccagaacttgtccggc
gacaccatgaagcgcaacatgctcgagttgggcggcaagtcggcctacctgctgctcgac
gacgccgacctcgacaccgcgctgcccggctgcgtcggggcgctgatgcacgccggccag
ggctgcgcgctgaccacccggatgctggtgccgcgcaagttctacgaccaggccgtcgag
gtggccaccgcgaccttcggggcgatcccggtcggcgacccggccgacccgaacgtcttc
tgcggcccgctggtctcggccaaacagcgcgaccgggtgctcaactacatcgagatcgcc
aagcgggagggcggccggatcaccgtgggcggtggcgcgcccgatggcctggaccgcggg
tacttcgtggcgccgacggtcatcgccgacgtcgaaccgcaccacaccgtgttccaggag
gagatcttcgggccggtgctcaccatcaccccgtacgacggcggcgacgacgaggcggtc
gcgttggcgaacaactccacctacggcctcgccggcgcggtcttcgggtcgccggagcgg
gcgatggccgtggcccgacggatccgcaccggctcgatgatggtcaacggcgcgctgtac
tacggggccgacgcgccgttcggcggctacaagatgagcggcatcggccggcagaacggc
cacgagggcttcgaacagtacctgcagaccaagacgattgcgtacccgatctcatga

DBGET integrated database retrieval system