KEGG   Mycolicibacterium hassiacum: MHAS_03462
Entry
MHAS_03462        CDS       T05715                                 

Gene name
bioI_3
Definition
(GenBank) Biotin biosynthesis cytochrome P450
Organism
mhas  Mycolicibacterium hassiacum
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: VCT91743
UniProt: K5BDT6
Position
1:3652963..3654192
AA seq 409 aa
MTAGSATRSVFDAGLPVLCYDVTATPQEIYPQFRAAQQQAPVALGPIGPEVLSYQLARTV
LRDPRFVVPQGIHLSAHGITSGELWDQVTRSILNMEGEEHRRLRGLVSRAFTPRATARMR
DTIHTVINELIDGVLGDGRCEFVAAIARPYPIPVICALLGAPRQDWQLFSRWAEDIFKIV
SFDCDLAAEQPAMLRAWDEFDAYIDEMIAARRRRLTDDLLSELIRAEIDGDRLNADELRM
LAFSVLIAGTDTTRTQLAASVQVLCDHPDQWALLRERPELAMRAVEETMRHSPSMCSTVR
TVAEDVTIDGYTFPAGTFIIVNTYAANRDAGVYDDPTRFDITRADPPPILTFGGGVHYCL
GANLARLELAEALTILSRRLRHPRRIGDVEWKPLLGMSGPRQLWIEFGS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgacagccggatccgccacccgcagcgtgttcgacgccgggttgccggtgctgtgctac
gacgtcaccgccaccccgcaggagatctatccgcagttccgcgccgcgcaacagcaggcg
ccggtcgcgctcggcccgatcggacccgaggtgctgtcctaccagctggcgcgcaccgtg
ctgcgcgatccgcggttcgtcgtcccgcagggaatacacctgtcggcgcacgggatcacc
tccggcgaactgtgggaccaggtcacccgcagcatcctcaacatggagggtgaggagcac
cgccggctgcgcgggctggtctcgcgggcgttcacaccgcgggccaccgcccggatgcgc
gacaccatccacacggtgatcaacgagttgatcgacggcgtcctcggcgacgggcgctgc
gagttcgtcgcggccatcgcgcggccgtatccgatcccggtcatctgcgcgctgctgggc
gcaccccgacaggactggcagctgttctcccggtgggccgaggacatcttcaagatcgtc
agcttcgactgcgatctggcggccgaacagccggcgatgctgcgggcctgggacgagttc
gacgcctacatcgacgagatgatcgccgcgcggcgccggcggctgaccgacgatctgctg
tcggagttgatccgcgccgagatcgacggcgaccggctcaacgccgacgagctgcgcatg
ctggcgttcagcgtgttgatcgccggaaccgacaccacccgaacccaactcgccgcttcg
gtgcaggtgctgtgcgaccaccccgaccagtgggcgctgctgcgggaacggccggagttg
gcgatgcgcgccgtcgaggagaccatgcggcattcgccgtcgatgtgcagcacggtgcgc
accgtcgccgaggatgtcacgatcgacggatacaccttcccggccggaacgttcatcatc
gtcaacacgtatgccgccaaccgcgacgccggtgtctacgacgatccgacgcgcttcgac
atcacccgcgccgatccgccgcccatcctgacgttcggcggcggggtgcactactgtctc
ggcgcgaatctggcgcgcctggaactggccgaggcgctgacgatcctgtcgcgccggttg
agacatccgcgccggatcggcgacgtggagtggaagccgctgctcggcatgagcgggccg
cggcagctgtggatcgagttcggctcctga

DBGET integrated database retrieval system