KEGG   Mycolicibacterium hassiacum: MHAS_04349Help
Entry
MHAS_04349        CDS       T05715                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mhas  Mycolicibacterium hassiacum
Pathway
mhas00260  Glycine, serine and threonine metabolism
mhas01100  Metabolic pathways
mhas01110  Biosynthesis of secondary metabolites
mhas01120  Microbial metabolism in diverse environments
mhas01130  Biosynthesis of antibiotics
mhas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MHAS_04349 (ltaE)
Enzymes [BR:mhas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MHAS_04349 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Glyco_hydro_20
Motif
Other DBs
NCBI-ProteinID: VCT92619
UniProt: K5B7E6
Position
1:4617509..4618609
Genome map
AA seq 366 aa AA seqDB search
MTLTRLHDPQSRSFASDNYAGAHPAVLAAIAAANDGHQPAYGEDVYTRRLQEVIRAHFGA
RAEVFPVFNGTGANVIALTAVLPRWGAVIAPDTAHIHTDEAGAPERVTGLKLLTVPSADG
KLTPELVAREAWGWGDEHRPQPLAVSITQTTERGTLYTPDEIRAVADYAHAHGMAVHLDG
ARIWNAAAALGVPLREFTTDAGVDVLSLGGTKNGLLGAEAVVVLDPDRAAGLTYLRKLGM
QLASKMRFLSAQLLALFDDDLGLRNAAHANAMTARLRAALAAGIADGRLPGLRFTQDSPA
NAIFAVLPEGMADRLRRRVHFYDWDAARREVRWMTAWDTTPEDVDRFVAIIFDEFGSSPP
SVKPRL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttgacgcgtctgcatgatccgcagtcccgcagcttcgccagtgacaactacgcc
ggcgcgcatccggcggtgctcgccgcgatcgccgccgccaacgacggccatcaacccgcc
tacggcgaggacgtctacacccggcggctgcaggaggtgatccgcgcgcactttggtgcg
cgcgccgaggtctttccggtgttcaacggcaccggcgcgaacgtcatcgcgttgaccgcg
gtgctgccccgctggggcgcggtgatcgcgccggacaccgcgcacatccacaccgacgag
gccggagcaccggaacgggtgaccggcctgaaactgctcaccgtgcccagcgccgacggc
aagctcacccccgaactcgtcgcgcgcgaggcctggggctggggcgacgagcaccgcccg
caaccactggcggtgagcatcacccagaccaccgagcggggcacgctctacacccccgac
gagatccgcgcggtcgccgactacgcccacgcccacggcatggcggtgcacctggacggc
gcgcggatctggaacgccgccgccgcgctcggtgtgccgctgcgcgagttcaccaccgac
gccggcgtcgacgtgctcagcctcggcggcaccaagaacggtctgctcggcgccgaggcc
gtcgtcgtgctcgacccggaccgcgccgccgggctcacctacctgcgcaagctcggcatg
cagctggccagcaagatgcggttcctgtcggcgcagctgctggcgctgttcgacgacgac
ctggggctgcgcaacgccgcgcacgccaacgcgatgaccgcgcggctgcgcgcggcgctg
gcggccggcatcgccgacggccgactgcccggcctgcgcttcacccaggacagcccggcc
aacgcgatcttcgcggtcctgccggagggcatggccgaccggttgcggcggcgggtgcac
ttctacgactgggacgccgcgcgccgcgaggtccgctggatgacggcctgggacaccacc
cccgaggacgtggacaggttcgtcgcgatcatcttcgacgagttcggttcgtccccgccg
agcgtgaagccgcggctgtga

DBGET integrated database retrieval system