KEGG   Mannheimia haemolytica USDA-ARS-USMARC-184: B824_14190Help
Entry
B824_14190        CDS       T03786                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
mhat  Mannheimia haemolytica USDA-ARS-USMARC-184
Pathway
mhat00130  Ubiquinone and other terpenoid-quinone biosynthesis
mhat00627  Aminobenzoate degradation
mhat01100  Metabolic pathways
mhat01110  Biosynthesis of secondary metabolites
mhat01120  Microbial metabolism in diverse environments
mhat01220  Degradation of aromatic compounds
Module
mhat_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:mhat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    B824_14190
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B824_14190
Enzymes [BR:mhat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     B824_14190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AJE08214
Position
1318771..1319337
Genome map
AA seq 188 aa AA seqDB search
MMKKRIIVGISGASGFQYGYKVLELLKPFSEIETHLVMTKGAELTRTLETDYTREALHEL
ADEIHSLNNVGASIASGSFKTAGMIVAPCSMRTLAAIANGFSDNLLTRAADVVLKERRKL
VLMVREAPLNLAHIDNMRKVTEMGGIIFPPIPAFYQQPKNLDEMVTHSVSHALSLLDIDI
PNTPHWGE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaacggattattgtcggcattagtggggcaagcggttttcaatatggctat
aaagtgttggaactgctgaaaccgttttcagaaattgaaacccaccttgtaatgaccaaa
ggggcggaactgactcgcacgcttgaaacagattatacccgagaagctctacacgagtta
gctgatgaaatacattcgctgaacaatgttggcgcaagcattgccagcggttcatttaaa
accgcaggaatgattgttgccccttgctctatgcgaacgcttgccgctattgctaatgga
tttagcgacaatttactaacccgtgcggcagacgtggtgttgaaagaacggcgtaaactg
gtattaatggtgagagaagctccgctcaaccttgctcacattgacaatatgcgaaaagtg
accgaaatgggcggaattatttttccaccgattccggcattttatcaacaacctaagaac
cttgatgaaatggtcacccacagcgtgagccacgccctttccctgttggatattgacatt
ccaaataccccacattggggagaataa

DBGET integrated database retrieval system