KEGG   Mannheimia haemolytica USDA-ARS-USMARC-184: B824_4360Help
Entry
B824_4360         CDS       T03786                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mhat  Mannheimia haemolytica USDA-ARS-USMARC-184
Pathway
mhat00030  Pentose phosphate pathway
mhat00480  Glutathione metabolism
mhat01100  Metabolic pathways
mhat01110  Biosynthesis of secondary metabolites
mhat01120  Microbial metabolism in diverse environments
mhat01130  Biosynthesis of antibiotics
mhat01200  Carbon metabolism
Module
mhat_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mhat_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mhat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B824_4360
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B824_4360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mhat04147]
    B824_4360
Enzymes [BR:mhat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     B824_4360
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     B824_4360
Exosome [BR:mhat04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   B824_4360
  Exosomal proteins of colorectal cancer cells
   B824_4360
  Exosomal proteins of bladder cancer cells
   B824_4360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJE07231
Position
complement(332153..333640)
Genome map
AA seq 495 aa AA seqDB search
MNAENSCIVIFGASGDLTFRKLIPALYNLYKIGRLGEHFSVLGVSRSELTDESFRQKMRD
ALVKFEKASGEELDKFCEHLYYQAVNTSDAVDYAKLLPRLDELHDKYQTAGNTLYYLSTP
PSLYGVIPECLAAHGLTTEEFGWKRIIVEKPFGYDIETAKKLDVQIHKCFEEHQIYRIDH
YLGKETVQNLLVLRFSNGLFEPLWNRNFIDYVEITGAESIGVEDRGGYYDGSGAMRDMFQ
NHLLQVLAMVAMEPPAIINANSMRDEVAKVLYCLHPLTEEDVKHNVVLGQYARGTVDGKE
VPAYLEEKGVPADSNTETFMAVKCEIDNWRWAGVPFYVRTGKRLPTRVTEIVIHFKTTPH
PVFSQNAPENKLIIRVQPDEGISMRFGLKKPGAGFEAKEVSMDFRYSDLSSSSSLLTAYE
RLLLDALKGDATLFARTDAVHACWKFVQPILGYKANRGRVYEYESGTWGPTEADKLIARH
GKVWRKPSGTMKKKV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgaaaatagctgtatcgtcatttttggtgcttccggtgacttaacttttcgt
aaattaattcctgctctttataacttatataagattggcagattgggcgagcatttttcc
gtcctaggtgtttctcgttcagaattaaccgacgaatctttccgccaaaaaatgcgtgat
gcgttagtcaaatttgaaaaagcaagcggtgaagaattagataaattttgcgaacatctt
tattaccaagctgtaaatacctctgatgcagtggattatgccaagttgctgcctcgtctt
gatgagctacacgataaatatcaaacagccggtaacacgctttattacctctccacgcca
ccaagtttatatggcgtgattccggaatgtttagccgctcacggcttaactaccgaagag
tttggctggaaacggattattgttgaaaaaccattcggctacgatatcgaaaccgccaaa
aaattagacgtacaaatccacaaatgctttgaagagcatcaaatctaccgtatcgaccac
tatttaggtaaagaaacggtacaaaacttactcgttttacgtttttctaacggcttattt
gaaccgctttggaaccgtaattttattgattatgtggaaattaccggggcagaatccatc
ggcgttgaagatcgtggcggttactatgatggctcgggggcaatgcgtgatatgttccaa
aaccacttattgcaagtattagccatggttgcaatggagccaccggcaattattaatgct
aattcaatgcgtgatgaagtcgcaaaagtgctatattgcttgcatccgctaactgaagaa
gacgttaaacacaatgtggtgttaggtcagtatgctcgtggcacggtagacggcaaagaa
gtgccggcttacttggaagaaaaaggcgtgccggctgattccaacactgaaacctttatg
gcggtaaaatgtgaaatcgataactggcgttgggcaggtgtgccgttctatgtgcgaacc
ggtaaacgcttaccaacccgtgtgacggaaatcgtaattcattttaaaactacaccacac
ccggtatttagccaaaatgctccggaaaataaattgattattcgtgtgcaaccggacgaa
ggcatttcaatgcgtttcggcttgaaaaaaccgggagcaggctttgaagcgaaagaagtc
tcaatggatttccgctattctgatttaagttcatcatcaagcttactcaccgcttatgaa
cgcttactcttagacgcacttaaaggtgatgcaaccttatttgcccgtactgatgctgta
cacgcttgttggaaatttgtgcaaccaattttaggctacaaagctaatcgtgggcgtgtg
tatgaatatgaatccggcacttgggggccaaccgaggcagataaattaatcgccagacac
ggcaaagtatggcgaaaaccgtccggtacaatgaagaagaaagtgtaa

DBGET integrated database retrieval system