KEGG   Methanohalophilus halophilus: BHR79_01390Help
Entry
BHR79_01390       CDS       T04572                                 

Definition
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
mhaz  Methanohalophilus halophilus
Pathway
mhaz00300  Lysine biosynthesis
mhaz00680  Methane metabolism
mhaz01100  Metabolic pathways
mhaz01120  Microbial metabolism in diverse environments
mhaz01130  Biosynthesis of antibiotics
mhaz01210  2-Oxocarboxylic acid metabolism
mhaz01230  Biosynthesis of amino acids
Module
mhaz_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mhaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BHR79_01390
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BHR79_01390
Enzymes [BR:mhaz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     BHR79_01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase
Motif
Other DBs
NCBI-ProteinID: APH38268
UniProt: A0A1L3Q070
Position
complement(280429..281670)
Genome map
AA seq 413 aa AA seqDB search
MSTISEKIFSRAAGKEAKANDFVIADIDYAMAHDGTSILAVRSFRQMEVENVWDPSRIVI
PFDHLAPANSDTTAGLQKDIRGWVRQQGIRNFYDIGNGICHQVLPEKGFAMPGKLIVGAD
SHSCTYGAFGTFGTGVGATDMAEIFASGKLWFRVPESIRVTAEGKLGERVYAKDLTLKII
GEVTASGATYKAVEFYGDAIEDLSMAGRMTLSNMAIEMGAKAGIVPPDATTFEYLKDRAV
SDYEPVYSDEDADYVAQYHIDVNSLEPQVACPHEVDNVCGVSGIAGKKLDQAFIGTCTNG
RLEDLEAAAEVLEGNEVAVRTIIIPASRQIMKEAARQGLIEIFLDAGATMGTPGCGPCLG
GHMGVIGEGEVCISTANRNFRGRMGTGGYIYLASPATVAASAIKGEITDPRKV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgagtactatcagcgagaagatattcagccgggcagccggcaaagaggcaaaggccaat
gattttgtgatagctgatattgattatgcaatggcccacgacggtaccagcattctggcc
gtccgttctttccgtcagatggaagttgaaaatgtctgggatccttcacgtatagtgatc
ccctttgaccatctggcaccagcgaattccgatactactgcaggtttgcagaaggatatc
aggggctgggtgcgtcagcagggcatacgcaatttctatgacattggtaacggtatctgc
catcaggtgttgcctgagaagggttttgcaatgccaggtaagttgatcgtgggtgctgac
tctcattcctgtacatatggtgccttcggtaccttcggtactggtgtaggggcaacggac
atggccgaaatattcgcatccggcaaactctggttccgtgtaccggaatccatcagggtt
acagctgaaggaaaactgggagagagggtttatgccaaggaccttaccctcaagatcatc
ggggaggtgaccgcttccggggcgacctacaaggcagttgaattctatggggatgccata
gaggacctttccatggcaggcaggatgaccctttccaatatggctatcgaaatgggtgcc
aaggcgggtatagtacctcccgatgccacgacctttgaatacctgaaagacagggcagtt
agtgattatgaacctgtttattcggatgaggatgcagattacgtagcccaatatcacatc
gatgtgaactcccttgaaccgcaggttgcctgtccccatgaagtggataacgtttgtggt
gtttccgggattgcaggcaaaaaactcgatcaggcatttattggtacctgtaccaatggc
cggctggaggatctcgaagctgcggcagaagttctggaaggaaatgaagttgctgtgagg
acgattataataccggcttccaggcagattatgaaggaagccgcaagacaaggattaata
gagattttcctagatgcaggtgcaactatgggtaccccgggatgcggtccatgtctgggt
ggtcacatgggagtaattggtgagggtgaagtatgtatttctactgcaaaccgcaacttc
cggggtcgtatgggtacaggtggctatatctatcttgcttcccccgcaacggttgctgct
tcggctataaaaggtgagattaccgatccgcgtaaggtatga

DBGET integrated database retrieval system