KEGG   Methanohalophilus halophilus: BHR79_04770Help
Entry
BHR79_04770       CDS       T04572                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase subunit A
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mhaz  Methanohalophilus halophilus
Pathway
mhaz00680  Methane metabolism
mhaz01100  Metabolic pathways
mhaz01120  Microbial metabolism in diverse environments
mhaz01200  Carbon metabolism
Module
mhaz_M00357  Methanogenesis, acetate => methane
mhaz_M00567  Methanogenesis, CO2 => methane
mhaz_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mhaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BHR79_04770
Enzymes [BR:mhaz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     BHR79_04770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA Par3_HAL_N_term MtrF
Motif
Other DBs
NCBI-ProteinID: APH38868
UniProt: A0A1L3Q1W8
Position
complement(966170..966892)
Genome map
AA seq 240 aa AA seqDB search
MAEKREPAPGWPILKGEYDVGDPESCVAVITLGSHLDGGPLLDAGASIAGPCKTENLGLE
KVVSHIIANPNIRYLVVTGSEVKGHITGEAFIMLHKNGVSDNRIVGATGAIPYVENLTEE
AVQRYQEQIECIDLIGTEDMGTISSKIKELAAKDPGAFDADPLVIEVGGEAEEEEEVGGL
KPMASEISVIRGRILDVEREMARIGEFNKFHAGIHAGKIEGIMIGLTITLSLLGLILFGR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaagagaaccagcaccaggatggccaatcctcaagggagaatacgacgta
ggagatccggaaagctgtgttgcagtaattactctgggttcacatctggatggaggacct
ctgctggatgcaggagcttcaattgcaggtccctgtaaaacagagaatctcggtctggaa
aaagttgtatcccacattattgcaaacccaaatataaggtacctggtcgtaaccggatct
gaagtaaaagggcacataaccggtgaagcatttataatgctgcacaaaaacggtgtcagt
gataacaggatcgtgggtgctacaggtgctattccctatgtcgagaacctgaccgaagaa
gctgtacagaggtatcaggaacagatcgaatgtatcgatcttattggtactgaagacatg
ggaactatcagcagcaagataaaggaacttgcagctaaggaccctggtgcttttgatgca
gatccccttgtgatagaagtcggcggtgaagcagaagaggaagaagaagtcggcggcctt
aaaccaatggcatccgaaatctctgtaattcgtggcaggatccttgatgtcgaaagggaa
atggccaggattggagagttcaataaattccatgccggtatccacgcaggcaagattgaa
ggaataatgatcggactaaccattacattgtccctgcttggcctgatattattcgggagg
tga

DBGET integrated database retrieval system