KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY1170Help
Entry
MARHY1170         CDS       T02083                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase, Acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00071  Fatty acid degradation
mhc00072  Synthesis and degradation of ketone bodies
mhc00280  Valine, leucine and isoleucine degradation
mhc00310  Lysine degradation
mhc00362  Benzoate degradation
mhc00380  Tryptophan metabolism
mhc00620  Pyruvate metabolism
mhc00630  Glyoxylate and dicarboxylate metabolism
mhc00640  Propanoate metabolism
mhc00650  Butanoate metabolism
mhc00900  Terpenoid backbone biosynthesis
mhc01100  Metabolic pathways
mhc01110  Biosynthesis of secondary metabolites
mhc01120  Microbial metabolism in diverse environments
mhc01130  Biosynthesis of antibiotics
mhc01200  Carbon metabolism
mhc01212  Fatty acid metabolism
mhc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MARHY1170 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    MARHY1170 (thlA)
   00640 Propanoate metabolism
    MARHY1170 (thlA)
   00650 Butanoate metabolism
    MARHY1170 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MARHY1170 (thlA)
   00072 Synthesis and degradation of ketone bodies
    MARHY1170 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MARHY1170 (thlA)
   00310 Lysine degradation
    MARHY1170 (thlA)
   00380 Tryptophan metabolism
    MARHY1170 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MARHY1170 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MARHY1170 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MARHY1170 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mhc04147]
    MARHY1170 (thlA)
Enzymes [BR:mhc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MARHY1170 (thlA)
Exosome [BR:mhc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MARHY1170 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CCG94650
UniProt: H8W921
Position
1201160..1202341
Genome map
AA seq 393 aa AA seqDB search
MNNNDIVIAGSARTPMGGMMGSLSTVRSPDLGAVAIKAAIERSGLQPADIQEVIMGCVLP
GGLGQAPARQASRASGIPDSSGCTTINKMCGSGMQAVIMAHDQIKAGTNNIMIAGGMENM
SQAPYLLPKARAGMRMGHGQVLDSMFLDGLEDAYEGGLMGVFAQRTADKFDITRQAMDEF
AIGSLQKSLAAIENGWFRDEIVPVTVPGRGGDTEVDTDEQPGNAKPEKIPHLKPAFAKDG
SVTAANSSSISDGASALVLASAAEADARGLTPQARVVAHATNARLPSEFTIAPIGSIEKV
LKKAGWTLDDVDLFEINEAFAVVTLAAINELKLPAEKVNVHGGACALGHPIGSSGSRIIV
TLINALKQRGLKRGVASLCIGGGEATAVAIELI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaatgacatcgttatagcaggctccgcccgaacccccatgggcggaatgatg
ggctccctgagtacggtacgttcaccggacctgggtgccgtcgccattaaggcagccatt
gaacgctccggccttcagccggcagacatccaggaagtgatcatgggctgcgtgctgccc
ggtggcttgggccaggcgccggcgcgtcaggcctcgagggcctctggcatcccggacagc
tccggctgcaccaccatcaacaaaatgtgcggctccggcatgcaggccgtcatcatggcc
cacgaccagatcaaagctggcaccaacaacatcatgatcgccggcggcatggaaaacatg
agccaggcaccgtacctgttgccgaaagcccgcgccggcatgcgcatgggccatggccag
gtactcgacagcatgttcctggacggcctggaagatgcctacgagggtggcctgatgggc
gtattcgcccagcgtacggcagataaattcgacatcacccgccaggctatggacgaattc
gccatcggctccctgcaaaaatccctggcggccatcgaaaacggctggttccgggacgaa
atcgtaccggtaaccgtcccgggccgaggcggcgacaccgaagtggataccgatgaacaa
ccgggcaacgccaaaccggaaaaaattccacacctcaaacccgcgttcgccaaggacggt
tctgtcaccgccgccaactccagctccatcagtgatggtgcttccgcgctggtactggcc
tccgccgccgaagccgatgcccggggcctgaccccgcaggcccgggtcgtggcccacgct
accaacgcacgcctgccgtccgaattcaccatcgcaccgatcggctccatcgagaaggtg
ctcaagaaagcggggtggacgctggacgatgtcgatctgttcgagatcaacgaagccttt
gccgtggtcaccctggcggcgatcaatgagctgaagcttcctgcggagaaggtcaacgtg
cacggcggtgcctgtgcactggggcatccgattggttcctccggctcccggatcatcgtc
accctgatcaatgcgttgaaacagcgtgggcttaagcgtggtgtagcctcgctctgcatc
ggtggtggtgaagccacggctgtggctattgagctgatctga

DBGET integrated database retrieval system