KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY1534Help
Entry
MARHY1534         CDS       T02083                                 

Definition
(GenBank) putative aminotransferase,(yfbQ) Putative aspartate aminotransferase (Transaminase A) (ASPAT)
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00220  Arginine biosynthesis
mhc00250  Alanine, aspartate and glutamate metabolism
mhc00290  Valine, leucine and isoleucine biosynthesis
mhc01100  Metabolic pathways
mhc01110  Biosynthesis of secondary metabolites
mhc01130  Biosynthesis of antibiotics
mhc01210  2-Oxocarboxylic acid metabolism
mhc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MARHY1534
   00290 Valine, leucine and isoleucine biosynthesis
    MARHY1534
   00220 Arginine biosynthesis
    MARHY1534
Enzymes [BR:mhc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MARHY1534
    2.6.1.66  valine---pyruvate transaminase
     MARHY1534
Amino acid related enzymes [BR:mhc01007]
 Aminotransferase (transaminase)
  Class I
   MARHY1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CCG95011
UniProt: H8WCI9
Position
complement(1596673..1597887)
Genome map
AA seq 404 aa AA seqDB search
MQNFFKSAKLDNVCYEIRGVVLREARRLEEEGHRVLKLNIGNPAAFELDVPEEIQQDVIY
NMHQAQGYVESKGLFSARKAVMHYCQQRGIAKVDIDDIYLGNGVSELIVMSMQALLNTGD
EVLIPAPDYPLWTAAVTLSSGKPVHYRCDEQQDWFPDIDDIRKKITRRTRAIVLINPNNP
TGAVYSEELLQQVLELAREHNLIILSDEIYDKILYDGTEHTSIASMADDVLFFTYNGLSK
NYRAAGYRSGWMIISGAKHKARDLIEGIDMLSNMRLCANVPAQLAIQTSLGGYQSINDLV
APGGRLYEQRETAWRMLNDIPGVSCVKPKGALYLFPRLDPKHFPVVNDEKLVLDLLLQEK
ILLVQGSAFNIDDKQHLRVVFLPRADTLSDAMGRLGNFLEHYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactttttcaaatccgccaagctcgacaatgtctgttatgaaattcgtggcgtg
gttctgcgtgaggcccgcaggctcgaagaagaagggcaccgcgttctgaagctgaatatc
ggcaatccggcagccttcgagctcgacgtgccggaagaaatccagcaagacgtcatctac
aacatgcatcaggcccagggctacgtggaatccaaaggcctgttttcggcccgaaaggcc
gtgatgcactattgccagcagcggggcattgccaaagtcgatattgatgacatctacctc
ggcaatggcgtcagcgagctgatcgtgatgtccatgcaggcattgctgaacaccggcgat
gaagtgctcattccggcccccgactatccgctctggaccgccgccgtcacgctgtccagc
ggcaagccggtgcattaccgctgcgacgaacaacaggactggttcccggacattgacgat
attcgcaaaaagattacccgccggacccgggctattgtgctgatcaacccgaataacccg
accggtgccgtgtattcagaggaactgctacagcaggttctggaactggccagggaacac
aatctgatcatcctgtcggacgagatctacgacaagatcctctacgacggtaccgagcac
acatccattgcctcgatggcggacgatgtgctgtttttcacttacaacggcctgtcgaag
aactaccgggcggctggttatcgttctggttggatgatcatcagcggagccaaacacaag
gcccgggatctgatcgaaggcatcgacatgctgtcgaacatgcgcctttgcgccaacgta
ccggcccagttggcgatccagacctctctgggcggctatcagtccatcaacgacctggtg
gcaccgggaggtcgtctgtacgagcagcgtgagaccgcctggcgcatgctgaatgacatt
cccggggtgagctgcgtcaagcccaaaggggcgctgtacctgtttccaagactggaccca
aagcacttccccgtggtgaatgacgagaagctggttctggatctgctgctccaggagaaa
atacttctggttcagggctcggccttcaacattgatgacaagcagcatctccgggttgtt
ttcctgcccagagcggacacgctgtcggatgccatgggccgtctgggcaatttccttgaa
cactatcgccagtaa

DBGET integrated database retrieval system