KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY2058Help
Entry
MARHY2058         CDS       T02083                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA m1G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mhc03009]
    MARHY2058 (rrmA)
Enzymes [BR:mhc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     MARHY2058 (rrmA)
Ribosome biogenesis [BR:mhc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MARHY2058 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_32 Methyltransf_23 ADH_zinc_N_2 TPMT MTS Ubie_methyltran Methyltransf_4 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: CCG95535
UniProt: H8W5W2
Position
complement(2100668..2101519)
Genome map
AA seq 283 aa AA seqDB search
MNTTSFESFACPLDGNPLQRENKVWRCPQGHSFDIARQGYVNLLPVQKKRSKEPGDSKAM
VAARQRFLEAGYYRPIADAVSAAILNGAATGSELSCLDAGCGEGYYLRQLASQEDEISLS
LLGLDISKWAVLAAARMEKRAGWVVGSNANLPVLPASVDRVLCLFGFPVYPEFARVLRPG
GRLVQVDAGQDHLRELREIVYPEVRADSRKVALVPEGFRRIGTQDLRFTVHLEGAEPIAD
LLAMTPHLYRASAEGRARAAALKALSVTVDVCLQTFERYNPAG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaccacttcctttgaatccttcgcctgtccgctcgacggcaatccgctacagcgg
gaaaacaaagtctggcgctgtccgcagggccatagcttcgatattgcccgccagggctac
gtaaatttgctgccagttcagaaaaagcgctcgaaagaacctggtgacagcaaagccatg
gtggccgcgcgccagcgctttctggaggcgggatactatcgcccgattgcggatgccgtg
tcggctgcaatcctgaacggcgctgcgacgggcagcgagctcagttgtctggatgccggc
tgtggtgagggctattatctgcgccaactagcgtcccaggaggacgaaatctcactatcg
ttgctcggactggacatttccaagtgggcggtgctggcggcggcgcgcatggaaaaacgc
gcaggttgggtggttggcagcaatgccaatctgccggtgttaccagcttcagtcgaccgt
gtgctttgccttttcgggttcccggtgtatccggagttcgcgcgggttttacggccaggc
gggcgactggtacaggtagacgccggccaggatcatctgagggagttgcgggagattgtc
tatccggaagttcgcgcagactctcgtaaagtggctctggtgccagaaggatttcggcga
atcggcacccaggatttacgcttcacagtgcatctcgaaggcgctgagcctattgccgat
ttattggcaatgaccccgcacctctaccgggcgagtgcggaaggcagggcacgggctgcg
gcgctgaaagcgttatcggtaaccgtggatgtctgcctgcaaacgtttgagcgttataat
cctgccggctga

DBGET integrated database retrieval system