KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY2724Help
Entry
MARHY2724         CDS       T02083                                 

Definition
(GenBank) putative cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MARHY2724
Enzymes [BR:mhc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MARHY2724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: CCG96188
UniProt: H8WC12
Position
2805240..2806418
Genome map
AA seq 392 aa AA seqDB search
MPIFSCLRTPQLIPLALTLLLAGTEASGANSSRPKNVTITDCEASISQLRRCYEQPPALW
PTPTIDEGVDYQELGLIPPPAKPDAREQKLRILGERLFFDPILSASEQLTCASCHHPDQR
FADGRRTSNGHRFQEGTRNSPSLLNTGLRDTWFWDGRASSLAEQAIEPMLNPIEMAGTRE
GIESRLNNSEHYRAEFQEIFGDHAITLEHAGEALETWQGTLRSRSAPFDRFLRGNRDALS
DQALLGLHLFRTRARCANCHMGPLLSDKKFHNIGLTYYGRKLEDLGRYNVTKKPADVGRF
RTPSLRDIAATGPYMHTGNFPHLRGILAMYNAGAPRPKPKEHQLTDPLFPQTSVLLKPLN
LEQHELDALESFLLSLTSGTANRRVVGIESKN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccgattttttcttgtttacgcacaccgcagctcattccccttgccctgactctcctg
ctggctggtaccgaggcttccggagcaaactcaagccgcccgaaaaatgtgacgatcacg
gattgcgaggcctccatttctcaactgagacgatgctacgagcagcccccggcactctgg
ccgacacccaccattgacgagggcgttgactaccaggaattggggttaatcccgccacca
gcaaaacctgatgccagggaacagaaactgaggattttgggcgaaaggctgtttttcgac
ccgatactgtccgcatcggagcagctcacctgcgccagttgccaccatccagatcaaagg
tttgccgatggccgccgcacctcgaacgggcacagatttcaggagggcacccggaacagc
cccagcttgttaaacaccggcctacgtgacacctggttctgggatggacgcgcatcctct
ctggctgaacaggccattgagcccatgcttaacccgattgagatggcaggaacccgggaa
ggcatagaatcaaggctcaacaattccgagcactaccgagcggaatttcaggaaatcttc
ggagaccatgccataacccttgagcatgctggggaggcattggaaacctggcagggtacg
ttacgctcacgatctgcgccgtttgatcgatttctgcgaggcaatagagacgcattaagt
gaccaggcactgctgggactgcatctttttcgcacccgggctcggtgcgccaattgccat
atgggaccgttattgtccgataaaaaattccacaatatcgggctgacctactacggccgg
aaactggaagatcttgggcgttataacgtgacgaaaaagccggccgatgtgggccgtttt
cgtacaccatcgttacgggatatcgccgcaacagggccttatatgcacaccggtaatttt
ccgcatctccgtgggattctggccatgtataacgccggggcaccaagacccaaacccaaa
gaacaccagctgactgaccctctatttccacaaacatccgtcctgctcaagccattgaac
cttgaacagcatgagcttgacgccctggaaagcttcctgctgagcctgacctccggaacg
gccaaccgaagggtggtcggtattgaaagcaaaaactga

DBGET integrated database retrieval system