KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3169Help
Entry
MARHY3169         CDS       T02083                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00010  Glycolysis / Gluconeogenesis
mhc00020  Citrate cycle (TCA cycle)
mhc00620  Pyruvate metabolism
mhc01100  Metabolic pathways
mhc01110  Biosynthesis of secondary metabolites
mhc01120  Microbial metabolism in diverse environments
mhc01130  Biosynthesis of antibiotics
mhc01200  Carbon metabolism
Module
mhc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MARHY3169 (aceF)
   00020 Citrate cycle (TCA cycle)
    MARHY3169 (aceF)
   00620 Pyruvate metabolism
    MARHY3169 (aceF)
Enzymes [BR:mhc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MARHY3169 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N Peptidase_M23 NQRA BUD22
Motif
Other DBs
NCBI-ProteinID: CCG96625
UniProt: H8W4N8
Position
complement(3248461..3250119)
Genome map
AA seq 552 aa AA seqDB search
MSEQEIKVPDLGGADEVEIIEIIVSEGDSVEEEDPILTVESDKASVELPAPAAGKITKIT
VKVGDKVKEGDVIGMLAASGDAGGSDDAADDKSEQTEEKSEAPSEAKSEDAKPAPKKKKS
GGSRTEVVKVPSLDGFEDVPVIEINVAEGDTVGEEDPLVTVESDKATMEIPSPYAGKIGK
ILVKEGDKLSEGSDLLEMTIEDDGDDEDEAADSGDSAQADSQESKPEKPQGKQESEPQPQ
GSTYEPPSPGTKVHAGPAVRKLARELGADLTRVKGSGPKGRIVKDDVHAYVKSQLQQAQQ
GSGVATGSGIPGVKLPDFSQFGEIEREGMSRMMAATATNMQRSWLNVPHVTQFDDADITE
MEDFRKAQKAAGEKRGVKMTPLPFLLKACAAALAELPQFNVSLDMERKEVVRKKYIHIGI
AVDTPHGLMVPVIRDVDQKGLWELAAESAELAQKARDKQLKPAEMQGACFTITSLGGIGG
TAFTPIVNTPEVAILGVSKASMKPVWDGREFQPRLMLPLSLSYDHRAVNGADAARFTNLL
TQLLGDIRTLLL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggaaatcaaggttcccgatctcggcggtgctgatgaagtcgagatcatc
gaaatcatcgtcagtgaaggggattcggtagaggaagaagatccgattctgaccgtggaa
tccgacaaagcctcggtagaactgccggcccccgccgccggcaagatcaccaaaatcacc
gtcaaggtgggtgacaaggtgaaagagggcgacgtgatcggcatgctggccgccagcggt
gatgctgggggctcggacgatgccgcggatgataagtcggaacagaccgaggaaaaatcc
gaggcgccatctgaggccaaatcggaagacgccaagccggctccgaaaaagaagaagtct
ggtggctctcgcaccgaagtggtgaaagtgccgtcgctggatggctttgaagatgtgccg
gtgattgaaatcaacgtggctgaaggcgatacggttggtgaggaagacccgctggtaaca
gtggagtccgacaaggccaccatggaaattccatcgccctacgcgggcaagatcggcaag
attctggtgaaggaaggcgacaagctctccgaaggttcagacctcctggaaatgaccatc
gaagacgatggtgacgacgaggacgaagcggcagattccggtgacagcgcacaggcagac
agccaggaaagcaaaccggagaaaccccagggcaaacaggaatccgagcctcagccgcag
ggctctacctacgagccaccgtcacctggcaccaaggtgcacgccggtccggccgtgcgt
aaacttgcccgggaactgggggcagacctcacgcgcgtgaaaggttcaggcccaaaaggc
cggatcgtgaaagacgatgtccacgcctacgtgaagagccagttgcagcaggcccagcag
ggcagtggcgtagccactggctctggcattccgggcgtgaagctgccggacttcagccag
tttggtgagatcgagcgtgaaggtatgtcccgcatgatggcggccaccgccaccaacatg
cagcgcagctggctgaacgtacctcacgtgacccagttcgacgatgccgatatcaccgaa
atggaagacttccgcaaggcccagaaagctgccggtgaaaagcgtggtgtgaagatgacc
ccgctgccgttcctgctcaaggcctgcgctgccgcgctggcggaactgcctcagttcaac
gtgtctctggacatggaacgcaaagaggtggtgcgcaagaagtacatccacatcggcatt
gcggtggatacaccacacggccttatggtgccggtgatccgggatgtagaccagaagggc
ctgtgggaactggcggccgaaagcgccgagttggcccagaaggcgagggacaagcagctg
aagccggcagaaatgcagggtgcctgctttaccatcaccagcctgggcggcattggcggc
acagcgttcacgccgatcgtgaatacgccggaagtggcgatcctgggtgtgtccaaagcc
tccatgaaaccggtgtgggacggcagggagttccagccgcggctgatgctgccgctgtcg
ctgtcttacgaccaccgcgcggtgaacggagcggatgctgcccggtttaccaacctgctg
acgcagctgctcggggatattcggaccctgctgctgtga

DBGET integrated database retrieval system