KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3629
Entry
MARHY3629         CDS       T02083                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mhc02044]
    MARHY3629
Secretion system [BR:mhc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   MARHY3629
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: CCG97083
UniProt: H8W8P9
Position
complement(3758748..3760058)
AA seq 436 aa
MAQQAAELTLVITNPTEIGGGASIEHSFGTRGGSIGTAASDSWQLSPHRTGAVAGHAEVR
YLDGGFCLIDRSGRTYINSSSQPVGRGRRARLSHGDTVTIGRYQIRAELSGVPAAVGETD
HDAREDHGLVDAPENGLRHAANEQNRPEGREPLEGLQPAAGDPVSCDPLAPWQQKPTRPD
EEAPELLASDQAWFARSAEVSDEYRENRDVAMGLPVTPQREHKERQGMSETTRNMREVSR
QHISGAPLLRGLDADIDFADSDEMRLFLEEAGQTLKATVEGLLALHQGEDSRHQALRTRL
QPIEDNPLRLANDYSDTIQTLFAAQRSPVHLSAPAAVRESLESLNHHQQATREAIREALE
AILHAFSPEALLRRFHGYRRGLQDNEDEGRWAWDMYQHYYRELKSSRQQGFERLFQEVFD
QAYDQHLRQLQREKLL
NT seq 1311 nt   +upstreamnt  +downstreamnt
gtggcacaacaagcagcagaactgacattagtgatcaccaacccgacggaaatcggtggt
ggcgccagcattgaacatagcttcggaacccgtggcggttccatcggcaccgcggccagc
gacagctggcagctttcgcctcaccgtaccggcgctgtcgccggccatgccgaggtgcgt
tacctggacggtggcttctgcctgattgatcgcagtggccggacctacatcaacagcagc
agtcagcctgtggggcggggccgtcgtgcccgactgagccacggcgacaccgtgaccata
ggccgctaccagatacgggccgaactctccggcgtcccggcggctgtcggtgaaaccgac
cacgacgcacgcgaagatcatggtctggtggatgcgccagagaatggtttacggcatgcc
gctaacgaacagaaccggcctgaaggtcgcgagcctctggagggtttgcagccggcagcc
ggcgatccggtcagctgtgatccgctggcgccctggcagcaaaaaccgacgcgcccggac
gaggaggctcccgagctgctggccagcgaccaagcctggtttgcccgttcggctgaggtt
agcgatgagtaccgggagaaccgggatgtggccatgggtctgccggtcaccccacaacgc
gagcataaggaacgacagggaatgtccgaaacgacacgaaacatgcgggaggtcagccgc
cagcacatcagtggtgcaccactgctccgggggctggatgcggatattgattttgccgac
agcgacgaaatgcggctgtttctggaggaagccggccagaccctgaaggcaacggtggaa
ggattactggcgctgcatcagggcgaagacagccgtcaccaggcgctgcgcacccgcttg
cagcccatcgaggacaacccgctgcggctggccaacgactattcggacaccattcagact
ctgtttgccgcccagcgcagcccggtgcatctgtcggcccccgccgctgtccgtgagagt
ctggaaagcctgaatcaccaccagcaggccacccgggaagccattcgcgaggcgctggaa
gccattctgcacgccttctcgccggaagccctgttgcgccggtttcacggctatcgccgt
ggtttgcaggacaacgaagacgagggccgctgggcctgggatatgtaccaacactattac
cgtgaactgaaatccagtcgtcagcagggttttgaacgcctgttccaggaagtgttcgac
caggcttatgaccaacacttgcgccaattacagagggagaaactgttgtga

DBGET integrated database retrieval system