KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3670Help
Entry
MARHY3670         CDS       T02083                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00270  Cysteine and methionine metabolism
mhc00480  Glutathione metabolism
mhc01100  Metabolic pathways
Module
mhc_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MARHY3670 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MARHY3670 (gshB)
Enzymes [BR:mhc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     MARHY3670 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CCG97124
UniProt: H8W8U0
Position
complement(3793683..3794636)
Genome map
AA seq 317 aa AA seqDB search
MTIRLGIVMDPIQDIHFKKDSSLAMLHAAQKRGWEIEYMELPDLYLAGGQARAHTRGLTV
HMDPDNWYSFGASQDRALGDLDVILMRQDPPVDREFLMATYILESAEQQGALVVNPAATL
RDCNEKLFATQFEDLTPPLIVTRSAQRFREFYAEHGDIIMKPVDGMGGRSIFRVKQNDAN
LGVIIETLTNYGSHQAMAQKFIPEITEGDKRILLIEGEPVPYALARIPSHGENRGNLAAG
GRGEGRELTERDRQICARVAPVIKEKGLMFVGLDVIGDYLTEINVTSPTCIRELDAAFGI
DIAGMLMDAIERRLARD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccggctggggatcgtgatggatcccattcaggatattcacttcaagaaagac
agttctctggccatgctgcatgccgcccagaaacgcggctgggaaatcgagtacatggaa
ctgccggatctttatcttgcgggcggccaggctcgggctcacacccgtgggctgactgtg
cacatggatccggacaactggtacagcttcggcgccagtcaggatcgtgcgctgggtgac
ctcgacgtcattctgatgcggcaggacccaccggtggatcgggagttcctgatggccacc
tatatactggaatcggcggagcagcagggcgctctggtggtcaatccggcggccaccctg
agggactgcaacgaaaaactgtttgccacccagtttgaagacctgacacctccgctgatc
gtgacccgctctgcccagcgtttccgggaattctatgccgagcatggtgacatcatcatg
aagccggtggacggcatgggtggccgctcgatattccgggtcaagcaaaacgacgccaat
ctcggggtcatcatcgaaaccctcaccaattacggcagccatcaggccatggcccagaag
ttcatccccgaaatcaccgaaggtgacaagcgtattctgctgattgagggcgagccggta
ccctatgcccttgcacgcattccgtcacacggtgagaatcgcggcaacctggccgccgga
ggtcgtggtgagggccgggagctgaccgagcgtgaccgtcagatctgtgcccgggtagcg
ccggtgatcaaggaaaagggcctgatgttcgtggggcttgatgtcattggtgactatctc
acggaaatcaacgtcaccagccccacctgcattcgtgagctggatgcggcgtttggcatc
gacattgccggcatgctgatggacgccatcgagcgacgtctggccagagactga

DBGET integrated database retrieval system