KEGG   Marinithermus hydrothermalis: Marky_0685Help
Entry
Marky_0685        CDS       T01457                                 

Definition
(GenBank) Sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
mhd  Marinithermus hydrothermalis
Brite
Enzymes [BR:mhd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     Marky_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: AEB11435
UniProt: F2NL32
Position
663415..665160
Genome map
AA seq 581 aa AA seqDB search
MAWDLSTLQERMRARLAFLYGAREAGAAWEAIAKRVAAFRDRHPEWLEQAPGLYADHTDV
LLITYGDQIRTPGEAPLRTLKAFMDAHLKDRVSGLHLLPHYPYSSDDGFSVIDYRRVNPE
LGTWADVEALARAYRLMLDAVINHISAQSPWFQAYRRGEAPYVHYFIELDPGTDTSTVYR
PREHPLLTPFETTRGTRYVWTTFSTDQVDLNYKNPAVLVEVLDVLLEYAAHGADLLRLDA
VGLLWKELGTSCLHLPQTHAVVKLIRDLLNATAPHVMLVPEINGPFEENLPYLGDGYDEA
QMIYNFTLPPLVLHAFYTGEATRLARWLEGVQLPSNQTAFFNFLASHDGIGVRPVEPLLP
PEEFQLLIERTLEHGGRVNYRRGPDGERRPYELCITYYDALTAPDESLDTGVARFRAAHA
ILLALAGVPGVYVHSLFGTPNWHEGYARTRQGRTLNRRKFTRAELEAALARPEGRFARVF
HEITRLLEARRAEPAFHPTALQRVLHLHPNVLALERTARAGYRLYALVNVSAHPVALSLE
GLRGGEVREVLTGTRYPIREGRLEVRLEPYGVRWLRELGTL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggacctatccaccctgcaagaacggatgcgcgcgcggctggccttcctgtac
ggcgcccgggaggccggggcggcctgggaggcgatcgcgaagcgggtcgcggcgtttcgc
gatcggcacccggagtggctcgagcaagcccctggcctgtacgctgaccacaccgacgtc
ctcctcatcacctacggcgaccaaatccggacgccgggagaggccccgttgcggacgctg
aaggccttcatggacgcgcacttaaaggaccgggtctctgggctgcacctgttgccgcac
tacccgtactcctccgacgacgggttcagcgtgatcgattaccggcgcgtgaaccccgag
ctggggacctgggcggacgtggaggccctcgcccgcgcgtaccgcttgatgctggacgcg
gtgatcaaccacatctccgcgcaaagcccgtggttccaagcctaccggcgcggggaggcc
ccgtacgtgcactacttcatcgagctggatccgggcacggacacctccacggtctaccgg
ccgcgggaacaccccctcctcacgcccttcgagaccacgcggggcacgcggtacgtctgg
actaccttctctaccgaccaggtcgacctcaactacaagaaccccgcggtcctcgtggag
gtgctcgacgtgctgctcgagtacgccgcgcacggggcggacctcctgaggctcgacgcg
gtcggcctactctggaaggagctcggcacctcctgcctgcacctcccccagacgcacgcg
gtggtcaagctgatccgcgacctcctgaacgccaccgccccgcacgtgatgctcgtccca
gagatcaacggacccttcgaggaaaacctcccgtacctcggggacgggtacgacgaggcg
cagatgatttacaacttcaccctgcctcccctggtgctgcacgccttctacaccggggaa
gcgacgcgcctcgcccgctggctcgagggcgtgcagctgccctcgaaccagacggccttc
ttcaacttcctggcctcccatgacgggatcggcgtccgaccggtcgagccgttgctgccc
cccgaggagttccagctcctcatcgagcggaccctcgagcacggcggccgggtcaattac
cgccggggccccgacggggagcggcggccctatgagctgtgcatcacgtactacgacgcc
ctcaccgccccggacgaatcgctggataccggcgtggcccgcttccgcgcggcgcacgcg
atcctcctcgccctggctggcgtcccgggggtgtacgtgcactcgttgttcggcaccccg
aactggcacgaggggtacgcgcgcacgcggcagggccgcaccctaaaccgccggaagttc
acccgcgccgagctcgaggccgccctcgcgcgcccagagggccggttcgcccgcgtgttt
cacgagatcacccggttgctcgaggcccgccgggccgagcccgccttccaccccaccgcg
ctgcagcgcgtgctccacctgcacccgaacgtgctggccctggagcgcaccgcccgcgcg
gggtaccggctctacgcgttggtgaacgtctccgcgcaccccgtcgccctcagcctcgag
gggctgcgtgggggggaggtgcgggaggtgcttaccgggacgcggtacccgatccgggaa
gggcggctcgaggtgcggctcgagccctacggggtgcggtggttgcgggagctgggtacg
ctataa

DBGET integrated database retrieval system