KEGG   Marinithermus hydrothermalis: Marky_0758Help
Entry
Marky_0758        CDS       T01457                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00010  Glycolysis / Gluconeogenesis
mhd00030  Pentose phosphate pathway
mhd00051  Fructose and mannose metabolism
mhd00680  Methane metabolism
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01200  Carbon metabolism
mhd01230  Biosynthesis of amino acids
Module
mhd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marky_0758
   00030 Pentose phosphate pathway
    Marky_0758
   00051 Fructose and mannose metabolism
    Marky_0758
  Energy metabolism
   00680 Methane metabolism
    Marky_0758
Enzymes [BR:mhd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Marky_0758
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Marky_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEB11508
UniProt: F2NM38
Position
733892..734995
Genome map
AA seq 367 aa AA seqDB search
MRLTLSMLKADIGAVGGHTAPSPEVLARVREVITEGQRAVFLDSLVFHCGDDIVVALTHT
RDPGDPEVHALAWEAFQEGTRVAQAQGLYGAGQDLLKDAFSGNLVGLGPQVAELQFEERP
NEPVVLLAADKTEPGAYNLPLYLAFADPMHSPGLLLSPGLQAGFRFRVMDVEATEAEHVI
DLAAPERLYDLAILLRDPHRFVIESIWSRKYPDEQAVAVSTTRLRNIAGRYVGKDDPVAI
VRVQKIFPATEELGPCFALAPFVAGDTRGSHHLPLMPVPANTPASSYFCMPMVMGLAVSI
KNGRFTRPVDMFSDPVWEHVRRHVVEKAMEMRRQGFVEPAMLPYGELEYTGIRDRLERLL
EEFTVRS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgacgctcagcatgctcaaggccgatatcggcgcggttggggggcataccgcg
cccagcccggaggtactggcgcgtgtgcgggaggtaatcacggaagggcagagggcggtc
ttcctggacagcctggtcttccactgcggggacgatatcgtggttgctctgacccacacc
cgtgacccgggggaccccgaggtgcacgcgctcgcctgggaggcctttcaggagggcacc
cgggtggcccaggcccaggggctgtacggggcggggcaggaccttttgaaggacgcgttc
agcggaaacctggtggggctcggcccgcaggtggcggaactgcagttcgaggagcgcccc
aacgagcccgtcgtgctgctcgccgcggacaagaccgagcccggcgcgtacaacctcccc
ctgtacctggctttcgccgaccccatgcactccccggggcttttgctctccccaggcctg
caagccggatttcgcttccgcgtcatggacgtggaagcaaccgaagcggagcacgtgatc
gacctcgcggctcccgagcggctctacgacctcgccatcctcctgcgggacccgcaccgg
ttcgtgatcgagtccatctggtcccgcaagtaccccgacgagcaggccgttgcggtgagc
accacccggctacgcaacatcgccgggcggtacgtgggcaaggacgacccggtcgcgatc
gtgcgcgtgcagaagatcttccccgccaccgaggagctggggccgtgcttcgccctcgct
ccgttcgttgcgggcgacacgcggggcagccatcacctgcccctcatgccggtccccgcg
aacaccccggcctcgagctacttctgcatgcccatggtgatggggcttgccgtctccatc
aagaacggccgcttcacgcgccccgttgatatgttcagcgaccccgtgtgggagcacgtg
cgccgccacgtcgtggagaaagccatggagatgcgccgccaggggtttgtcgagcccgcg
atgctcccgtacggggagctcgagtacaccgggattcgcgatcggctcgagcgcctcctc
gaggagttcacggttcggtcgtga

DBGET integrated database retrieval system