KEGG   Marinithermus hydrothermalis: Marky_1193Help
Entry
Marky_1193        CDS       T01457                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00900  Terpenoid backbone biosynthesis
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Marky_1193
Enzymes [BR:mhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Marky_1193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Sacchrp_dh_NADP Epimerase
Motif
Other DBs
NCBI-ProteinID: AEB11933
UniProt: F2NQJ5
Position
complement(1177812..1178918)
Genome map
AA seq 368 aa AA seqDB search
MKRVVILGSTGSIGTQALEVCRWRGYRVVGLAAGRNLDRLAAQIQEFNPQIVSAHPELLP
ELRARFPRVTFTDQAEEVAAHPADVVVSAIPGLAGLAPTRAAARQGVRLALANKESMVAA
GPLLWAEVEAAGGEILPVDSEHSALFQSLVGERLEDVHELILTASGGPFREGPEDLSRVT
PEMALAHPRWNMGPKVTIDSATLMNKGLEVLEAVQLFRVPLERVRVLIHPQAYVHSLVRF
VDGQLKAQLGPTDMRLPIQYALTYPERAPNPLAALPLEARLEFYPPDTTRFPALELAYAA
GRMGGLAPTVLNAADEVAVEAFLAGRIPFTRIPEIISRVLEDTPREPVTWESVYRADRWA
RERAKECI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgtcgtcatcctgggctcgaccggatccatcggcacccaagccctcgaggtc
tgccgctggcgcgggtaccgcgtcgtgggcctcgccgcgggccggaacctcgatcgtctc
gccgcgcaaatccaggagttcaaccctcagatcgtctccgcgcaccccgaactcctcccc
gagctgcgtgcacgcttcccacgcgtcaccttcacggaccaggccgaggaggtcgcggcg
catcccgcggacgtggtcgtctccgcgatcccggggctcgccgggctcgctcccacccgc
gcggccgcccgccaaggcgtccggctggcccttgcgaacaaggaaagcatggtcgccgca
gggcccttgctctgggcggaagtcgaagcggccggcggggagatcctccccgtggattcc
gagcactccgccctcttccagtccctcgtaggggaacggctcgaggacgtacacgagctc
atcctcaccgcctccggcggcccgttccgcgaagggccggaggacctgagccgagtcacg
cccgagatggccttggcccacccccgctggaacatgggcccgaaggtcacgatcgactcc
gcgaccctcatgaacaaggggctggaggtgctcgaggccgtccagctcttccgcgtgccg
ctcgagcgcgttcgggtcctgatccacccccaagcgtacgtgcactccctggtgcgcttc
gtggacgggcagctcaaggcgcagctcggcccgacggacatgcggctccccatccagtac
gccctcacctaccccgagcgcgcccccaacccgctcgcggcgctccccctggaggcacgg
ctcgagttctaccctccggacaccacccggttcccggcgctcgagctcgcgtacgcggct
gggcggatgggggggctggcccccacggtcctgaacgccgcggatgaggtggcggtcgag
gcgttcctcgcggggcggattcccttcacgcgcattcccgagattataagccgcgtcctg
gaggataccccccgcgagccagtaacctgggagagtgtgtaccgggcggatcgttgggcc
cgggaacgcgcaaaggagtgcatatga

DBGET integrated database retrieval system