KEGG   Marinithermus hydrothermalis: Marky_1438Help
Entry
Marky_1438        CDS       T01457                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00020  Citrate cycle (TCA cycle)
mhd00480  Glutathione metabolism
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01200  Carbon metabolism
mhd01210  2-Oxocarboxylic acid metabolism
mhd01230  Biosynthesis of amino acids
Module
mhd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mhd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marky_1438
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Marky_1438
Enzymes [BR:mhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Marky_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEB12173
UniProt: F2NMK3
Position
1449064..1450341
Genome map
AA seq 425 aa AA seqDB search
MAYQKIRVPEGDKITLENGKLNVPDQPIIAFIEGDGTGPDIWRAAQPVLDAAVERAYGGR
RRIAWMEVYAGEKANRVYGEEVWLPEETLEAIDEYVIAIKGPLTTPVGTGIRSINVALRQ
KLDLYACVRPVRHFTGVPSPVRHPELVNMVVFRENTEDIYAGIEWKKGSEEVKKFLSLLR
EHFPEAYQKIRFPETSGIGIKPVSEEGTKRLVEAAIQYAIDNDLPSVTLVHKGNIMKFTE
GAFRDWGYEVARERFGAEPLDGGPWHVLKNPKTGKEIVVKDVIADAMLQQVLTRPAEYSV
IATLNLNGDYLSDALAAQVGGIGIAPGANINYKTGRAIFEATHGTAPKYAGQDKVNPSSV
ILSGEMMLRHLGWHEAADLIIQAMNRTIQQGRVTYDFHRLLVAEGKPATLLKTSEFGQAL
IENMG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgtaccagaagattcgagttcctgagggcgacaagatcacgctcgaaaacggtaaa
ctcaacgtcccggatcagcccatcatcgccttcatcgagggcgacgggaccggccccgat
atctggagagccgcccagccggtcctggacgctgccgtagaacgggcgtacgggggccga
cggcggatcgcctggatggaggtgtacgctggggaaaaggccaatcgggtctacggcgag
gaggtctggctccctgaggaaaccctcgaggccatcgacgagtacgtgatcgcgatcaag
ggtccgctcaccacgccggtcgggaccgggatccgctcgatcaacgtggccctgcgccag
aagctagacctgtacgcgtgcgtgcggccggtgcggcactttacgggcgtgcccagcccg
gtgcggcacccggagctcgtgaacatggtggtcttccgggagaacacggaggacatctac
gcagggatcgagtggaagaagggcagcgaggaggtcaagaagttcctgagcctgctccgc
gagcacttcccggaagcctaccagaagatccgcttccccgagacctcgggcatcggaatc
aagcccgtgagcgaggagggcacgaaacgcctggtggaggccgcgatccagtacgcgatt
gacaacgacctgcccagcgtcaccctcgtgcataagggcaacatcatgaagttcaccgag
ggcgcgttccgcgactgggggtacgaggttgcgcgggagcgctttggggccgagcccctc
gacggcggtccctggcacgtcctgaagaaccccaagaccggcaaggagatcgtcgtgaag
gacgtgatcgcggacgcgatgctgcagcaggtcctcacccgtcccgccgagtacagcgtg
atcgccacgctgaacctgaacggcgactacctctccgacgccctcgccgcgcaggtaggc
gggatcggcatcgcccccggcgcgaacatcaactacaagaccggccgggcgatcttcgag
gccacgcatggcaccgcacccaagtacgccggccaggacaaggtcaacccctcctcggtc
atcctctccggcgagatgatgctgcgccacctcggctggcacgaggccgcggacctgatc
atccaggccatgaaccgcacgatccagcagggccgcgtcacctacgacttccaccgcctc
ctcgtcgccgaaggcaagccggccaccctcctcaagaccagcgagttcggtcaggccttg
atcgagaacatgggttaa

DBGET integrated database retrieval system