KEGG   Marinithermus hydrothermalis: Marky_1617Help
Entry
Marky_1617        CDS       T01457                                 

Definition
(GenBank) succinate dehydrogenase cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00020  Citrate cycle (TCA cycle)
mhd00190  Oxidative phosphorylation
mhd00650  Butanoate metabolism
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01200  Carbon metabolism
Module
mhd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mhd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mhd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marky_1617
   00650 Butanoate metabolism
    Marky_1617
  Energy metabolism
   00190 Oxidative phosphorylation
    Marky_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF3687 TMEM72
Motif
Other DBs
NCBI-ProteinID: AEB12352
UniProt: F2NKA3
Position
complement(1630769..1631164)
Genome map
AA seq 131 aa AA seqDB search
MAIRARRYEDAKQQAGTNLELAWWVFMRISGLLLVFLALGHLYIQNILINAGEIDYDYVA
KRLSQTTWKVYDWLLLALALLHGTNGMRYVIDDLVRNPAVRFWVKTVFYTVVAILFFLGS
LVLFNYDFQIS
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgattcgagcgcggcgctacgaggacgcgaagcagcaggccggcacgaacctcgag
ctggcctggtgggtgttcatgcggatatcgggcctcttgctcgttttcttggccctggga
cacctgtacatccaaaacatcctgatcaacgcgggagagatcgattacgactacgtggcg
aagcggctgagccagaccacctggaaggtgtacgactggttgctcctcgcgctggcgttg
ctgcacggtacgaacggtatgcggtacgtgatcgacgacctggtgcggaacccggccgtg
cgtttttgggtgaagacggtgttctacacggtggtggcgatcctgttcttcctggggagc
ctggtgctcttcaattacgacttccagatttcgtaa

DBGET integrated database retrieval system