KEGG   Marinithermus hydrothermalis: Marky_1721Help
Entry
Marky_1721        CDS       T01457                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mhd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Marky_1721
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mhd03011]
    Marky_1721
Ribosome [BR:mhd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Marky_1721
  Bacteria
    Marky_1721
  Archaea
    Marky_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEB12456
UniProt: F2NMS2
Position
complement(1722280..1722621)
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARYVRMSPRKVRLVVDLIRGKSVEEADVLLRYLNKRAARPVRKVLKSAVANAVN
NHNLLEDALYVKAAYVDEGPALKRILPRARGRADIIKKRTSHITIIVEERNGQ
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccaaagccgttgccaggtacgtgcgcatgtctcctcgaaaggtccggctggtc
gtggacctgattcgcggcaagagcgtggaggaggcggacgttctgctgcgttacctgaac
aagcgcgctgcacggccggtgcgcaaggtgctgaagagcgctgtggcgaacgcggtgaac
aaccacaacctcttggaggacgccctctacgtgaaggccgcgtacgtggacgaggggcct
gcgctcaagcgcatcctgccgcgggctcggggacgggcggacatcatcaagaagcgcacc
agccacatcacgatcatcgtggaggaacgcaatgggcaataa

DBGET integrated database retrieval system