KEGG   Marinithermus hydrothermalis: Marky_1785Help
Entry
Marky_1785        CDS       T01457                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00010  Glycolysis / Gluconeogenesis
mhd00030  Pentose phosphate pathway
mhd00051  Fructose and mannose metabolism
mhd00052  Galactose metabolism
mhd00680  Methane metabolism
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01200  Carbon metabolism
mhd01230  Biosynthesis of amino acids
mhd03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marky_1785
   00030 Pentose phosphate pathway
    Marky_1785
   00051 Fructose and mannose metabolism
    Marky_1785
   00052 Galactose metabolism
    Marky_1785
  Energy metabolism
   00680 Methane metabolism
    Marky_1785
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Marky_1785
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Marky_1785
Protein phosphatases and associated proteins [BR:mhd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Marky_1785
Messenger RNA biogenesis [BR:mhd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Marky_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_6 PucR LpxK Peripla_BP_1 PA Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AEB12518
UniProt: F2NPL7
Position
complement(1778934..1779902)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVLTSGGDAPGMNAAIRAVVRVAHTQGVEVVGIRRGYAGMIEGEFQPLGPRDVANI
IQRGGTILLTARSKAFMTREGRAQAAAHLKNAGIDGLVVIGGDGTFHGAIKLIKEHQIPV
VGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHGRVFFIEVMGRDAGFIALD
VGIAGGAEIIALPEISVSPQEIAEVITRSAEKGKQSSIVVVAEGAYPGGAEALMRAVAEL
TGLEGRVTVLGHIQRGGSPTAKDRVLASRLGGAAAEALIGGASGVMLGEVEGEVALTPLH
EAVGNRKDIRRELYELARVLAV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggatcggggtgttgaccagcgggggagacgcccccggcatgaacgcggccata
cgggccgtggtgcgcgtagcgcacacccagggcgtcgaggtcgtggggatccgccgtggg
tacgcaggcatgatcgagggagagttccagccgctcgggccgcgcgacgtcgccaacatc
atccagcggggcggcacgatcctcctcaccgcgcgcagcaaggccttcatgacgcgggaa
ggacgagcccaggccgcggcgcacctcaagaacgcgggcatcgacggcctcgtcgtgatc
ggaggagacggcaccttccacggcgcgatcaagctgatcaaggagcaccagatccccgta
gtgggggtgcccggcacgatcgacaacgacctgtacgggaccgactacacgatcgggttc
gacactgcggtgaacaccgccctcgaggccatcgaccggattcgcgacaccgccgcgagc
cacgggcgcgtcttcttcatcgaggtgatggggcgggacgcggggttcatcgccctcgac
gtggggatcgccggcggtgcggagatcatcgcgctgccggagatcagcgtgagcccgcag
gagatcgccgaggtgatcacgcgctccgcggaaaaaggcaagcagtcctcgatcgtggtg
gtggccgaaggcgcgtaccccggaggggccgaggccctgatgcgcgcggtggcggaactc
accggtctcgaggggcgcgttacggtgctcggccacatccagcggggcggcagccccacg
gcgaaggaccgggtcctggcgagccgcttgggcggcgcggccgccgaggccctgatcggc
ggggcgagcggtgtgatgctaggcgaggtggagggggaggtggccctaacgccgctgcac
gaggccgtagggaaccgcaaggacatccggcgcgagttgtacgagctcgcgcgggtcctg
gccgtgtaa

DBGET integrated database retrieval system