KEGG   Marinithermus hydrothermalis: Marky_1792Help
Entry
Marky_1792        CDS       T01457                                 

Definition
(GenBank) N-acylmannosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00010  Glycolysis / Gluconeogenesis
mhd00052  Galactose metabolism
mhd00500  Starch and sucrose metabolism
mhd00520  Amino sugar and nucleotide sugar metabolism
mhd00521  Streptomycin biosynthesis
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marky_1792
   00052 Galactose metabolism
    Marky_1792
   00500 Starch and sucrose metabolism
    Marky_1792
   00520 Amino sugar and nucleotide sugar metabolism
    Marky_1792
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Marky_1792
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Marky_1792
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Marky_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FtsA
Motif
Other DBs
NCBI-ProteinID: AEB12525
UniProt: F2NPM4
Position
complement(1784526..1785422)
Genome map
AA seq 298 aa AA seqDB search
MATVGVDLGGTKIAAGVLADGRVRARTVRPTPKEGGLAVVEAMAACVRAAIQESGLSGVK
AVGVGSPGPLDFERGRVRFAPNIPNLTDFPLREALAEAVGLPVVLENDANAAALAEHHLG
AAKDAQSSVYVTVSTGIGGGVVFGDRVWRGAFGQGGEVGHFVVLPHGPVCGCGQSGCLEA
LASGVAIARDARYAYKREMDTPEVFARWRKGEPKARRIVEQAADYLGLGLASLQRVLDPE
VFVLGGGVVLGGGAAYLELVQAAFARYTEGWRAGALRVAALGKEAGWIGAALAAELSG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggtaggggtggacctgggcggcaccaagatcgctgcgggtgttttggcggac
gggcgggtgcgcgcgcggaccgtgcggcccacccctaaggagggcgggctggccgtggtg
gaggcgatggcggcgtgcgtgcgcgccgcgatccaggaaagcggcctctccggcgtgaag
gccgtgggggtcggctcgcccgggccgttggattttgagcgcggccgggtgcggttcgcg
ccgaacatcccgaacctcacggacttccccttgagggaggcgctcgccgaggcggtgggg
ctgccggtggtgctggagaacgacgcgaacgccgcggcgctcgcggagcaccacctgggc
gcggcgaaggacgcgcaaagctcggtgtacgtcacggtctcgaccggaatcgggggcggc
gtggtttttggggaccgggtctggcgcggcgcgttcgggcaggggggggaggtcgggcat
ttcgtcgtgctgccgcacggcccggtctgcggttgcggccagtccggctgcctcgaggcc
ctcgcctcgggcgtggcgatcgcgcgggacgcgcgctacgcctacaagcgagagatggac
acccccgaggtgttcgcgcgctggcgaaaaggcgagcccaaagcccggcggatcgtggag
caagccgcggactacctggggctggggctggcctccctgcagcgggtgctggaccccgag
gtgttcgtgctggggggcggcgtggtgctcgggggcggggcggcctacctcgagctcgtg
caggccgcgttcgcgcgctacaccgagggctggcgggcgggcgcgctgcgcgtcgcggcg
ctcggcaaggaggccggctggatcggggcggccttggccgcggagctctcggggtga

DBGET integrated database retrieval system