KEGG   Marinithermus hydrothermalis: Marky_1881Help
Entry
Marky_1881        CDS       T01457                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00780  Biotin metabolism
mhd01100  Metabolic pathways
Module
mhd_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mhd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Marky_1881
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhd01007]
    Marky_1881
Enzymes [BR:mhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Marky_1881
Amino acid related enzymes [BR:mhd01007]
 Aminotransferase (transaminase)
  Class II
   Marky_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1 Flg_hook
Motif
Other DBs
NCBI-ProteinID: AEB12612
UniProt: F2NR34
Position
complement(1884605..1885777)
Genome map
AA seq 390 aa AA seqDB search
MTDWERQLELWAARGLRRTLRPLAAAGPRVEREGRYLINLASNDYLGLSTDPRLVRAAQE
ALARWGVGAGASRLVSGDRRVHAALEAALADFKGTEAALVFTSGYAANVGVLAALAGPRD
QIFADALNHASLNDGARLSRARLRYYRHRDLDHLEDLLKGPGPRRGGRRFIVTDAVFSMD
ADLAPLPALVELAERYEALLVVDDAHGSGVVGPEGRGTVHHFGLAGRVPVQVATLSKALG
GQGGVVAGARALVEVLLHRARAFIYSTGIAPALAAAALEAVRLVRGPEGEARRARLRQHL
ARLKAELRAKGYRVLHEDPAPMLLVWVGAPGPALRLAAHLEARGVLAPAIRPPTVPEGTS
RLRLAPMATHTEVEIERVIQAFPPAEEVGV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacggactgggagcggcagctcgagctgtgggcggcccgcggcctgcggcgcacctta
cggccccttgcagctgcgggaccgcgggtcgaacgcgaaggccggtacctgatcaacctg
gcctcgaacgactacctgggcttgtccaccgatccccggctggtgcgggccgcccaggag
gcgttggcgcggtggggggtgggggccggggcctcccggctggtttcgggggaccggagg
gtacacgcagccctcgaggcggccctcgcggacttcaaaggcacggaagccgcgctggtc
ttcaccagcgggtacgcggccaacgtgggggtgctcgccgcgctcgccgggccgcgcgac
cagatcttcgccgacgcgctgaaccacgcgagcctgaacgacggggcgcgcctcagccgg
gcgcggctccgctactaccgccaccgggacctcgatcacctcgaggacttgctcaagggg
ccggggccccgacgtggagggcggcgcttcatcgtgaccgacgcggtcttcagcatggac
gccgacctagcccctttgccggcgcttgtggagctcgcggagcgctacgaagcgctcctc
gtcgtggacgacgcgcacgggagtggcgtggtgggccccgaggggcgcgggacggtgcac
cacttcggcctcgccgggcgggtcccggtccaggtggccaccctctccaaggcccttggg
gggcaagggggggtggtggcgggtgcacgggcgttggtggaggtgctgttgcaccgggcc
cgggcgttcatctacagcacgggaatcgccccggccctagctgcggctgcgctcgaggcg
gtgcgcctcgttcgtggtccggagggggaggcccgccgggcgcgcctcaggcagcacctg
gcccggctgaaggccgagcttagggccaaggggtaccgggtgctgcacgaggacccagcc
ccgatgcttctcgtgtgggtgggggcgccggggcctgcgctccgcctcgcggcgcacctc
gaggcccggggggtcctcgccccggcgatccgaccccctaccgtaccggagggcacgagc
cggttgcggttggccccgatggccacccacaccgaggtggagatcgagcgcgtgattcag
gcgttccccccggcagaggaggtgggggtgtga

DBGET integrated database retrieval system