KEGG   Marinithermus hydrothermalis: Marky_2087Help
Entry
Marky_2087        CDS       T01457                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00071  Fatty acid degradation
mhd00280  Valine, leucine and isoleucine degradation
mhd00281  Geraniol degradation
mhd00310  Lysine degradation
mhd00360  Phenylalanine metabolism
mhd00362  Benzoate degradation
mhd00380  Tryptophan metabolism
mhd00410  beta-Alanine metabolism
mhd00627  Aminobenzoate degradation
mhd00640  Propanoate metabolism
mhd00650  Butanoate metabolism
mhd00903  Limonene and pinene degradation
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01212  Fatty acid metabolism
Module
mhd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Marky_2087
   00650 Butanoate metabolism
    Marky_2087
  Lipid metabolism
   00071 Fatty acid degradation
    Marky_2087
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Marky_2087
   00310 Lysine degradation
    Marky_2087
   00360 Phenylalanine metabolism
    Marky_2087
   00380 Tryptophan metabolism
    Marky_2087
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Marky_2087
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Marky_2087
   00281 Geraniol degradation
    Marky_2087
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Marky_2087
   00627 Aminobenzoate degradation
    Marky_2087
   00930 Caprolactam degradation
    Marky_2087
Enzymes [BR:mhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Marky_2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEB12812
UniProt: F2NN73
Position
2101452..2102255
Genome map
AA seq 267 aa AA seqDB search
MDTAKYQALKFQHPAEGVLEIVLEQPERLNAVDQIGHRELAYVWRDVDEDPSVRAVLIRG
SGKGFSAGGDFALIEEMMADYRTLVRVWKEARDLVYNVINCSKPIVSAIHGPAVGAGLAV
ALLADVSIAAKSAKILDGHTRLGVAAGDHAAIVWPLLVGMAKAKYYLLTNEPLNGAEAER
IGLVSLAVEDDALYETALSVAKRLAAGSPTALRWTKYALNNWLRLAGPTFDTSLALEFLG
FLGPDAKEGLAAIKERRRPEFEKDVPL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgcgaagtaccaggccttaaagttccagcaccccgcggagggcgtgctggag
atcgtgctcgagcagccggagcgcctgaacgccgtggatcaaatcgggcaccgcgagctc
gcgtacgtgtggcgcgacgtggacgaggaccccagcgtccgcgcggtcctcatacgcggc
agcggcaaggggttttccgccgggggggatttcgcgcttatcgaggagatgatggcggac
taccggaccctggtgcgggtgtggaaggaggcccgggacctcgtctacaacgtgatcaac
tgctccaagcccatcgtctccgcgattcacgggcccgcggtcggcgcaggactcgcggtc
gcgctgctcgcggacgtctcgatcgcggcgaaaagcgcgaagatcctcgacgggcacacg
cggctcggcgtggccgcgggcgaccacgcggccatcgtctggccgcttttggtcggcatg
gccaaggccaagtactacctcctcacgaacgagccgctgaatggcgcggaggccgaacgg
atcgggctggtctccctcgcggtggaggacgacgcgctttacgagacggccctaagcgtc
gcgaaacgcctcgcggcgggcagccccaccgcgcttcgctggaccaagtacgccctcaac
aactggttgcgcctcgccggccccaccttcgacacctccctcgccctggagttcctgggc
tttttggggccggacgcgaaggaagggctcgccgccatcaaggaacggcgccgcccggag
ttcgagaaggacgtacccctatag

DBGET integrated database retrieval system