KEGG   Mycoplasma haemocanis: MHC_05395Help
Entry
MHC_05395         CDS       T01666                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mhe  Mycoplasma haemocanis
Pathway
mhe03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mhe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MHC_05395 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mhe03011]
    MHC_05395 (rplV)
Ribosome [BR:mhe03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MHC_05395 (rplV)
  Bacteria
    MHC_05395 (rplV)
  Archaea
    MHC_05395 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEW45933
UniProt: H6N8G1
Position
complement(825880..826353)
Genome map
AA seq 157 aa AA seqDB search
MIARAIQRNVHVSSKKAVLCCRLIRNKSYMEAIRILDNQPQKTAKFLKKLLMSAAANAVN
NHAMSGDKLYVFSSSANQGRTLKRTIPRAKGRADLIRKRFSHLEICLSDDKDERKKLNVY
LLKPRAHQHKYKPKLVDRSVEIKPKSIMQNESDGSKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctagagctatccaaaggaatgttcatgtatcctctaagaaagcagttctctgt
tgtcgtcttattaggaataaatcttatatggaggctattagaattctggataatcaaccc
caaaagacagctaaatttcttaaaaaactacttatgtctgcagcggccaatgctgttaat
aatcatgccatgtcaggagataagctttatgtatttagctcttccgccaatcaaggaaga
actttaaagagaactattcctagggctaaggggcgtgccgatttaataagaaaaagattt
tctcatttggaaatatgtctttctgatgataaggatgaaagaaagaaattaaatgtttac
ctattgaaaccgagagctcaccaacataagtacaaacctaagttggttgataggtctgtt
gagataaagcctaagtctattatgcagaacgaaagcgatgggtcaaaaggttaa

DBGET integrated database retrieval system