KEGG   Mycoplasma haemocanis: MHC_05725Help
Entry
MHC_05725         CDS       T01666                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhe  Mycoplasma haemocanis
Pathway
mhe00010  Glycolysis / Gluconeogenesis
mhe00051  Fructose and mannose metabolism
mhe01100  Metabolic pathways
mhe01110  Biosynthesis of secondary metabolites
mhe01120  Microbial metabolism in diverse environments
mhe01130  Biosynthesis of antibiotics
mhe01200  Carbon metabolism
mhe01230  Biosynthesis of amino acids
Module
mhe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHC_05725 (tpiA)
   00051 Fructose and mannose metabolism
    MHC_05725 (tpiA)
   00562 Inositol phosphate metabolism
    MHC_05725 (tpiA)
Enzymes [BR:mhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MHC_05725 (tpiA)
Exosome [BR:mhe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MHC_05725 (tpiA)
  Exosomal proteins of bladder cancer cells
   MHC_05725 (tpiA)
  Exosomal proteins of melanoma cells
   MHC_05725 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEW45998
UniProt: H6N8M6
Position
complement(894436..895143)
Genome map
AA seq 235 aa AA seqDB search
MKIVFGNLKMNFLYKDFQDYIENLRMKFLSETPKVHLGLAIPYIYLKNASESIGSKIKVL
AQDLHPVDFGAFTSSVSAAQLASLNVPATLIGHSECRQLSQNSFVISNKVKSALRNGLEI
IYCCGEDPEREISEELFFMNGDEISKVIIAYEPISSIGTGQAMDPNGADSTLLRIRDLIS
DKYGRKVADSMKLLYGGSVNLSNYKGYLEKKNIDGVLVGGASLKVEDLWKMAILE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtatttgggaacctaaagatgaacttcctttacaaggattttcaggattat
atagagaatctgagaatgaagttcttgtctgaaactcctaaggttcatttggggttggct
attccttacatatacttgaagaatgcttctgagtctattggatcaaagattaaggtatta
gctcaagatctgcatcctgtggattttggtgcattcacttcttctgtttccgcagctcaa
ttggcttcgcttaatgttcctgcaacattaattggtcactcggagtgtagacagttgagt
cagaattcctttgttatttcgaataaggtaaagtctgctctaagaaatggattggaaatt
atctattgttgtggagaagatcctgagagggagatatctgaagagttgtttttcatgaat
ggagatgagataagtaaggtgataatagcttacgaacctatttcttctataggaactggt
caagctatggatcctaatggagctgattctacccttcttagaataagggatctaatatct
gataagtatggaagaaaggtagctgattcaatgaagttattgtacggtggttctgttaat
ttatccaactataagggctatttggaaaagaaaaatatagacggagttttagttggtggg
gcttccttgaaggttgaggatctttgaaagatggcaatcttagagtaa

DBGET integrated database retrieval system