KEGG   Megamonas hypermegale: MHY_24890Help
Entry
MHY_24890         CDS       T02593                                 

Definition
(GenBank) Beta-eliminating lyase.
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mhg  Megamonas hypermegale
Pathway
mhg00260  Glycine, serine and threonine metabolism
mhg01100  Metabolic pathways
mhg01110  Biosynthesis of secondary metabolites
mhg01120  Microbial metabolism in diverse environments
mhg01130  Biosynthesis of antibiotics
mhg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MHY_24890
Enzymes [BR:mhg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MHY_24890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBL07072
Position
complement(1866044..1866325)
Genome map
AA seq 93 aa AA seqDB search
MQDIAKYCDVFYIGGTKVGALFGEAVVITKPNLIPHFFTIIKQHGALLAKGRLLGIQFDT
LFTDNLYLKIAKNAIEKAEQLKAIFKEKIINSS
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatcgctaaatattgtgatgtattttatattggcggtacaaaagttggtgca
ttattcggtgaagcagtagtaatcacaaaaccaaatttaatacctcatttcttcactatc
atcaaacaacatggggcattacttgctaaaggtagactactcggtattcaattcgatact
ttatttactgataatctctatcttaaaatcgctaaaaatgccattgaaaaagctgaacaa
ttaaaagctatcttcaaagaaaaaattataaattcttcttag

DBGET integrated database retrieval system