KEGG   Mycoplasma hyorhinis GDL-1: MYM_0413Help
Entry
MYM_0413          CDS       T01730                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mhh  Mycoplasma hyorhinis GDL-1
Pathway
mhh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mhh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MYM_0413 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mhh03011]
    MYM_0413 (rplV)
Ribosome [BR:mhh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MYM_0413 (rplV)
  Bacteria
    MYM_0413 (rplV)
  Archaea
    MYM_0413 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF2397
Motif
Other DBs
NCBI-ProteinID: AEX14181
Position
complement(493520..493885)
Genome map
AA seq 121 aa AA seqDB search
MENKSQQARASVKMQRISAQKARLVARLIKKQPTTNALAILQNTNKKASYFFIKLLNSAV
ANAVNNHGLNGDSLVVKDVIVNEGPTLKRFQPRAKGVAYRILKRTSHLAVVVEEVSLLGD
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaatcacaacaagcaagagctagtgtaaaaatgcaacgtatttcagctcaa
aaagctcgtttagttgcacgtttaattaaaaaacaaccaactacaaatgcattagctatt
ttacaaaatacaaataaaaaagcttcatatttcttcataaaactattaaactcagctgta
gcaaatgctgttaataaccatggattaaacggtgatagtttagtagttaaagatgtaatt
gtaaatgaaggtccaacacttaaaagatttcaaccaagagcaaaaggtgttgcatatcgt
attttaaaaagaacttctcatttagctgtagtagttgaagaagtaagtttattaggagat
aaataa

DBGET integrated database retrieval system