KEGG   Methanosaeta harundinacea: Mhar_0495Help
Entry
Mhar_0495         CDS       T01990                                 

Definition
(GenBank) Methyl-coenzyme M reductase, beta subunit
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00680  Methane metabolism
mhi01100  Metabolic pathways
mhi01120  Microbial metabolism in diverse environments
mhi01200  Carbon metabolism
Module
mhi_M00357  Methanogenesis, acetate => methane
mhi_M00567  Methanogenesis, CO2 => methane
mhi_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mhi00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mhar_0495
Enzymes [BR:mhi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     Mhar_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: AET63877
UniProt: G7WN21
Position
497949..499253
Genome map
AA seq 434 aa AA seqDB search
MSDKIDLYSDRGVLLKSDVDLSAVSPLKNAAMKKLINLTKRTVAVNLAGIENALKTGKVG
GQGRQIKGRELKYDVVANANALAAEIKKLLQVEAGDDTNVQVLGGGKQLLVQIPTARVDA
ASEFVVGMTATAAATCEALVTQFKAGMFEAPMVHAAVWGQYPQTVPMAGGNIASVLNIPQ
NDEGLGFALRNIMANHIAAITKRNAMNAAALSSIYEQIGNFEMGNAIGIFERYQMLGLAY
QGLNANNMVYDLVKSNGKTGTIGTVVHSVVERAVEDKVIKAGEKLPSGFVMYEAVDVPMW
NAYCAAGTLAATMVNCGALRGAQAVSSTLLYFNDVIEKETALPGCDWGKVMGTAVGFSFF
SHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVSAAVALDAGTQMFTPEMTSGLVGAVYGEI
KEFREPIVAVAEAV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacaaaatagacctctatagtgaccgtggcgttcttttaaagagtgacgttgac
ctgagcgccgtcagcccactcaagaacgcggcgatgaagaagctgatcaacctgaccaag
cggaccgtagcggtcaacctggcgggaatcgagaacgccctgaagaccggaaaggtcggc
gggcaggggaggcagatcaagggacgcgagctcaagtacgacgtcgtcgccaacgccaac
gccctcgccgccgagatcaagaagctcctccaggtcgaagccggagacgacaccaacgtc
caggtcctgggtggaggaaagcagctcctcgtccagatcccgactgccagggtcgacgcc
gcctccgagttcgtcgtcgggatgaccgcaacggcagccgccacctgtgaggcgctcgtc
actcagttcaaggccggaatgtttgaagcccccatggtccacgccgcagtctggggccag
tacccgcagaccgtccccatggccggcggaaacatcgcctctgttctcaacatcccccag
aacgatgaaggtctcggcttcgctcttcgaaacatcatggccaaccacatcgcggccatc
accaagaggaacgccatgaacgctgcagccctctcttccatctacgagcagatcggaaac
ttcgagatgggcaacgccataggcatcttcgagaggtaccagatgctgggcctcgcctac
cagggcctcaacgccaacaacatggtctacgacctggtcaagtccaacggcaagaccgga
accatcgggaccgtcgtccacagcgtcgtggagagggccgtcgaggataaggtcatcaag
gccggcgagaagctcccctccgggttcgtcatgtacgaggccgtcgatgtccccatgtgg
aacgcctactgtgcagcaggcaccctcgcagccaccatggtcaactgcggcgctctccga
ggcgctcaggccgtctcctcaaccctgctctacttcaacgacgtcatcgagaaagagacc
gccctgcccggctgtgactggggcaaggtcatgggaaccgccgtcgggttctccttcttc
agccactccatctacggcggcggcggacctggcgtcttcaacggcaaccacgtcgtgacg
aggcactcccgaggattcgccatcccctgcgtgtccgcagcggttgctcttgacgccgga
actcagatgttcactccggagatgacctccggtctggtgggagccgtctacggagagatc
aaggagttccgcgagcctatcgtagcagttgcggaggctgtatag

DBGET integrated database retrieval system