KEGG   Methanosaeta harundinacea: Mhar_0751Help
Entry
Mhar_0751         CDS       T01990                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00010  Glycolysis / Gluconeogenesis
mhi00620  Pyruvate metabolism
mhi00640  Propanoate metabolism
mhi00680  Methane metabolism
mhi00720  Carbon fixation pathways in prokaryotes
mhi01100  Metabolic pathways
mhi01110  Biosynthesis of secondary metabolites
mhi01120  Microbial metabolism in diverse environments
mhi01130  Biosynthesis of antibiotics
mhi01200  Carbon metabolism
Module
mhi_M00357  Methanogenesis, acetate => methane
mhi_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_0751
   00620 Pyruvate metabolism
    Mhar_0751
   00640 Propanoate metabolism
    Mhar_0751
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhar_0751
   00680 Methane metabolism
    Mhar_0751
Enzymes [BR:mhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mhar_0751
Lipid biosynthesis proteins [BR:mhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mhar_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AET64124
UniProt: G7WKU1
Position
complement(807658..809646)
Genome map
AA seq 662 aa AA seqDB search
MAEGKTGTTKVLMEETRIFEPPKALAENCNAWQWAKKKGFKTEKEMRAWCGEHYLEFWDE
MAKTYADWYKPYTKVMDDSGMPYFKWFTGGKVNVFYNAIERHIKAGKGAKVAYHFIPEPT
DQAEKDYTYQEIYETVNKLANGLKSLGVVKGDRVSIYMPMLPETVMAMLACAKIGAIHSL
VFSGFSSKGFGDRVDDCQAKVVFTSDGFYRRGKPMPLKPQADEATKGIQSVKNVIVLKRT
GIEVPWNDAKDVWFHELIKGQSAECKTEELDAEDRLFILYTSGTTGKPKGIEHAHGGYCV
TPAQTLHWVFDLKENDVWWCTADVGWITGHSYVAYGPLCLGATTIMYEGSPDFPDFGRWY
KIIQEQKVTVFYTAPTAVRMLMKQGEEWPAKYDLSSIRLLGSVGEPLNPEAYIWYRKNFA
YDKAPIMDTWWQTETGCFVISPLPMTPCKPGSVAYPLPGFNTTIYDEEGNEVPLGEGGNI
VNPTPWPSMLRAFYKDEVRYKKEYWDMYWKVKPGTYLAGDKATRDKDGYWFVQGRIDDVL
SVAGHRIANAEVESSLVAHKDVSEAAVIGKPDEIKGEAIIAFVILKKDVKPSDDLAKELK
THVRTTMGPLAIPAGVYFVDDLPKTRSGKIMRRVVKAKALGNPTGDTSALANPEAVDGIP
LI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaaggaaaaactggaacgaccaaggttctgatggaagagacgaggatcttcgag
ccgccaaaggccttggccgagaactgcaacgcctggcagtgggcgaagaagaaggggttc
aagactgagaaggagatgcgggcctggtgcggcgagcattacctcgagttctgggacgag
atggccaagacctacgccgactggtacaagccctacaccaaggtgatggacgactccggg
atgccgtacttcaagtggtttactggcggcaaggtcaacgtcttctacaacgccatagag
aggcacatcaaggcaggaaagggcgcaaaggtagcataccacttcatccccgagccgacc
gaccaagccgagaaggactacacctaccaggagatctacgagaccgtcaacaagctggcc
aacggcctcaagagcctcggcgtagtcaagggcgacagggtctccatctacatgcccatg
ctccccgagaccgtcatggcgatgctcgcctgcgccaagatcggcgccatccacagcctc
gtcttctccgggttcagctccaagggattcggcgacagggtcgacgactgccaggcgaag
gtcgtcttcacctccgatggcttctacaggcgcggaaagccgatgcccctcaagccccag
gccgacgaggcgaccaaggggattcagagcgtcaagaacgtcatcgtcctcaagaggacg
gggatcgaggtcccatggaacgacgccaaagatgtctggttccacgagctgatcaagggc
cagtctgccgagtgtaagaccgaggagctggacgccgaggacaggctctttatcctctac
acctccgggaccaccggcaagcccaaggggatcgagcacgcccacggcggatactgcgtc
accccagcccagaccctccactgggtcttcgacctgaaggagaacgacgtctggtggtgt
accgccgacgtaggctggatcacaggccactcctatgtcgcctatggacccctctgtctc
ggcgcgaccaccataatgtacgagggctctcccgacttccccgacttcggccgctggtac
aagatcatccaggagcagaaggtcaccgtcttctacaccgcccccaccgcggtgcggatg
ctgatgaagcagggcgaggaatggcccgccaagtacgacctctccagcataaggctgctg
gggtccgtcggcgagcccctcaaccccgaggcgtacatctggtaccggaagaacttcgcc
tacgacaaggcccccatcatggacacctggtggcagacggagacgggctgcttcgtcata
tccccgctgcccatgaccccctgcaagcccggctccgtggcgtaccccctgcccggcttc
aacaccaccatctacgatgaggaaggaaacgaggtccccctgggagagggcgggaacata
gtcaaccccaccccctggccgtcgatgctcagggccttctacaaggacgaagtccggtac
aagaaagagtactgggacatgtactggaaggtcaagcccggcacctacctcgccggagac
aaggccaccagggacaaggacggatactggttcgtccagggaaggatcgacgacgtcctc
agcgtcgctggccacaggatcgccaacgccgaggtcgagtcatccctcgtagcccacaag
gacgtctctgaggctgcagtcatcggcaagcccgatgagatcaagggcgaggcgatcatc
gccttcgtcatcctgaagaaggacgtcaagccctccgacgatctcgccaaggagctgaag
acccacgtcaggacgaccatgggacccctggccatacccgccggcgtctacttcgtcgac
gacctgcccaagaccaggtccggcaagatcatgcgccgggtggtcaaggccaaggccctc
ggaaaccccaccggagacacctccgccctcgccaaccccgaggctgtggacggcatcccc
ctcatctga

DBGET integrated database retrieval system