KEGG   Methanosaeta harundinacea: Mhar_1975Help
Entry
Mhar_1975         CDS       T01990                                 

Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00260  Glycine, serine and threonine metabolism
mhi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mhi01100  Metabolic pathways
mhi01110  Biosynthesis of secondary metabolites
mhi01130  Biosynthesis of antibiotics
mhi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhar_1975
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhar_1975
Enzymes [BR:mhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mhar_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB NanE ThiG DHO_dh ALF
Motif
Other DBs
NCBI-ProteinID: AET65331
UniProt: G7WR28
Position
complement(2128561..2129346)
Genome map
AA seq 261 aa AA seqDB search
MRLAEAFRRRPLLIAYICAGDPSPEATVEVAELLARAGADVVELGLPHSDPIADGPVIQA
AAQRAIEAGMNTDVYFETASRIRAKIPLVFMGYYNMIYQRGLEKFAGDCGASGITGLIVP
DLPPEEAGPLRAACRRADLDLISLIAPNTPAERIPLIAENSSGFLYLVARAGVTGARSEV
LQSTKALIERVNSELPRAVGFGISTPEQAAEVIRAGADAAIVGSACVDLISKGDLAGLEE
LIRGMKAAIGEARPIEAAARI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcgccgaggccttcaggcgccgccccctcctcatcgcctacatctgcgccggc
gaccccagccccgaggcgacggtggaggtggcggagctcctcgcccgggccggggccgac
gtcgtcgagctggggctcccccactctgacccgatagccgacggccccgtcatccaggcg
gcggcccagagggcgatcgaggcggggatgaacaccgacgtatacttcgagactgcctcc
cggatcagggcgaagatccccctggtcttcatgggctactacaacatgatctaccagcgg
gggcttgagaagttcgccggcgactgcggggcgagcggcatcaccggcctcatcgtcccc
gaccttccgccggaggaggcgggccccttgcgggcggcctgcaggagggcggacctcgac
ctgatatccctcatcgccccgaataccccggcggagaggatccccctcatcgcagaaaat
tccagtggcttcctctacctcgtcgcccgggcgggggtgacgggggccaggtccgaggtg
ctgcagtcgacgaaggccctcatcgagcgggtgaactccgagctgcccagggccgtcggc
ttcggcatctcaaccccggagcaggcggcggaggtgatccgggccggagccgacgccgcc
atcgtcggatccgcctgcgtcgacctgatctcgaagggcgaccttgcggggctggaggag
ctgatccgcgggatgaaggcggcgatcggagaggcgcggccgatcgaggcggcggcgagg
atctga

DBGET integrated database retrieval system