KEGG   Methanosaeta harundinacea: Mhar_2045Help
Entry
Mhar_2045         CDS       T01990                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00900  Terpenoid backbone biosynthesis
mhi01110  Biosynthesis of secondary metabolites
mhi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mhi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mhar_2045
Enzymes [BR:mhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Mhar_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AET65401
UniProt: G7WPN9
Position
complement(2209752..2211008)
Genome map
AA seq 418 aa AA seqDB search
MKTSRISGFYKLSAPDRLKMVAENSGLSEAEVEAIGSLGLSLDQADKMVENVVGLFQIPL
GIATNFLIDGREVLVPMATEEPSVIAAASNGARMALAGGGFVTSSTEPVMRALIQVTGVD
DPWGTRLAILARSGEIAARANEKDPMLVSHGGGVVGVEAEVVETRKGPMVVVHLLVDCRD
AMGANAVNTMAEALAPFIEEITGGRVYLRIISNLADLRLARARAVFKAEEIGGAEVVDGI
VLASALAESDPYRAATHNKGIMNGVTAVTMATGNDTRAIEAGAHSYAARGGMYRSLSVYE
KNRDGDLVGSIELPVAVGTVGGATRVHPVARAAVRVLGLRSADDLGRILASVGLAQNFAA
LRALATEGIQRGHMSLHARNVAVQAGAKGDEIEAVAGKMAAEKRINVDRAKELLSGMR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgaagacgtcgagaatttcggggttttataagctttcagcgccggatcggctgaagatg
gtggcggagaactctggtctctccgaggcggaggtggaggcgatcggcagcctgggcctc
tccctcgatcaggccgacaagatggtcgagaacgtggtggggctctttcagatacccctg
gggatcgccaccaacttcctcatcgacggccgggaggtgctcgtccccatggctacggag
gagccttcggtgatcgccgccgccagcaacggggccaggatggccctcgccgggggtggc
ttcgtcaccagcagcaccgagcccgtgatgcgggccctcatccaggtgacgggggtcgat
gacccctggggaacgcggctcgccatcctcgcccgctctggggagatcgcggcgagggcg
aacgagaaggacccgatgctcgtcagccatgggggcggggtcgtcggggtcgaggcggag
gtcgtcgagacgaggaaggggccgatggtggtggtccacctgcttgtcgactgccgggac
gccatgggcgccaacgccgtcaacaccatggccgaggccctcgcccccttcatcgaggag
atcaccggcgggagggtctacctcaggatcatatccaacctcgcggacctccgcctcgcc
cgcgcccgggccgtcttcaaggccgaggagatcggcggggccgaggtcgtcgacggcatc
gtcctcgcctccgctctggcggagagcgacccctatcgggccgccacccacaacaagggg
atcatgaacggggtgacggcggtgaccatggcgaccggtaacgacaccagggcgattgag
gccggagcccactcctacgccgcccggggtgggatgtacaggtccctctccgtctacgag
aagaaccgggacggtgacctcgtcggatcgatagagctccccgtcgccgtggggaccgtc
gggggcgcgacgagggtccaccccgtcgccagggcagccgtccgggtactggggctcaga
tccgccgacgacctcggccggatcctggcgtcggtgggcctcgcccagaacttcgccgcc
ctccgggccctcgccaccgaggggatccagaggggtcacatgtctctgcacgcccggaac
gtcgccgtccaggccggcgctaagggggatgagatcgaggcggtggcgggtaaaatggcg
gcggagaagaggatcaacgtcgatcgggccaaggagctgctgagcgggatgagatga

DBGET integrated database retrieval system